BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_B01 (842 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.13c |||protein disulfide isomerase |Schizosaccharomyces ... 29 1.1 SPBC31F10.12 |||RNA-binding protein Tma20 |Schizosaccharomyces p... 27 2.5 SPBC1604.16c |||RNA-binding protein, G-patch type |Schizosacchar... 26 7.7 >SPBC3D6.13c |||protein disulfide isomerase |Schizosaccharomyces pombe|chr 2|||Manual Length = 726 Score = 28.7 bits (61), Expect = 1.1 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 267 SRSNSKDSLAEDNVSQSSLSGGIKGKLVALFSKEQTISETSIANK 401 S S S SLA +S+S+ + G V SK+ T S TS+A+K Sbjct: 165 STSVSSLSLASTAMSKSASASEFSGSSVTKASKKLTSSPTSVASK 209 >SPBC31F10.12 |||RNA-binding protein Tma20 |Schizosaccharomyces pombe|chr 2|||Manual Length = 184 Score = 27.5 bits (58), Expect = 2.5 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 255 ITKNSRSNSKDSLAEDNVSQSSLSGGIKGKLVALFSKEQTISETSIANKFRL 410 I +R NS++ + +SS+ GIK KLV + + + + I K +L Sbjct: 2 IANLNRFNSREDIKGTTPIKSSIQRGIKAKLVQAYPNLKQVIDELIPKKSQL 53 >SPBC1604.16c |||RNA-binding protein, G-patch type |Schizosaccharomyces pombe|chr 2|||Manual Length = 199 Score = 25.8 bits (54), Expect = 7.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 443 ILQHLHIPLSFQPELISYRRLAYRLL 366 +L HI FQP L+ + L YR+L Sbjct: 95 LLSSQHISNKFQPHLLKPKSLGYRVL 120 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,659,158 Number of Sequences: 5004 Number of extensions: 45040 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 416455520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -