BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_A20 (839 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyce... 30 0.47 SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces ... 26 7.6 >SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 715 Score = 29.9 bits (64), Expect = 0.47 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = -1 Query: 305 SCFPSLVEFVMSRFDRSTWALITIASSV*NAPSFEENP*SVSG 177 S FPSL + ++ + + TW L IAS+ + S+ +NP VSG Sbjct: 410 SAFPSLAKNPVNPYSKDTWNLNVIASTNGSLLSYIDNP--VSG 450 >SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.8 bits (54), Expect = 7.6 Identities = 18/65 (27%), Positives = 30/65 (46%) Frame = -2 Query: 457 SPNHPSQKGRQL*TVDNNPGNFCMYPSCPLSIHIPRRKRPRLIAV*LAIAEVVFRLWLNS 278 SP HP Q L + +N F M P+ + H+P + I L++ V+ W++S Sbjct: 597 SPTHPQQA---LKSSSSNDFYFLMKPNECIFTHVPENPDQQFIMPDLSMPIVMALPWVSS 653 Query: 277 LCHVL 263 + L Sbjct: 654 VYFTL 658 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,074,834 Number of Sequences: 5004 Number of extensions: 62798 Number of successful extensions: 177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 414453330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -