BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_A20 (839 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70682-9|CAA94587.2| 460|Caenorhabditis elegans Hypothetical pr... 28 7.2 Z70680-9|CAA94576.2| 460|Caenorhabditis elegans Hypothetical pr... 28 7.2 Z50044-6|CAA90358.1| 223|Caenorhabditis elegans Hypothetical pr... 28 7.2 AF003151-17|ABJ99068.1| 99|Caenorhabditis elegans Hypothetical... 28 9.5 >Z70682-9|CAA94587.2| 460|Caenorhabditis elegans Hypothetical protein C25G4.1 protein. Length = 460 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -2 Query: 622 HDLRRQVSEVVDPAIILIFAHPVLXEEG*QPALYSIH--QKPPCCLR 488 H+L + S ++ P++ L+FA VL + P S H +K CC + Sbjct: 267 HNLFKIFSNMLFPSLFLVFASAVLASDDLNPCNSSWHFFKKTGCCYK 313 >Z70680-9|CAA94576.2| 460|Caenorhabditis elegans Hypothetical protein C25G4.1 protein. Length = 460 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -2 Query: 622 HDLRRQVSEVVDPAIILIFAHPVLXEEG*QPALYSIH--QKPPCCLR 488 H+L + S ++ P++ L+FA VL + P S H +K CC + Sbjct: 267 HNLFKIFSNMLFPSLFLVFASAVLASDDLNPCNSSWHFFKKTGCCYK 313 >Z50044-6|CAA90358.1| 223|Caenorhabditis elegans Hypothetical protein F22B5.6 protein. Length = 223 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 406 NP-GNFCMYPSCPLSIHIPRRKRPRLIAV*LAIAEVVFRLWLNSLCHVL 263 NP G F SC LS I ++KRP L + V WL + H++ Sbjct: 3 NPYGTFAYVNSCCLSTWISQKKRPSYFLEALILPTVPESWWLLAQYHII 51 >AF003151-17|ABJ99068.1| 99|Caenorhabditis elegans Hypothetical protein D1007.19 protein. Length = 99 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 520 SIHQKPPCCLRLCSYTCRNAPSPNHPSQKGRQ 425 +I+ P C+R C++ + P HP+ + RQ Sbjct: 30 AIYTSPVQCVRCCTHYVKRRSLPLHPAHRKRQ 61 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,604,545 Number of Sequences: 27780 Number of extensions: 382037 Number of successful extensions: 1093 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2077023564 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -