BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_A19 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 2.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 3.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 3.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 3.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 3.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 3.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 3.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 3.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 5.9 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 307 YRETSRERSRDRRGRGRSREHRIIPSHYI 335 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 59 YRETSRERSRDRRERGRSREHRIIPSHYI 87 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 292 YRETSKERSRDRRERGRSREHRIIPSHYI 320 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 249 YSRISTSRYRGRSARYATDAPTLLPSHYV 335 Y S R R R R + ++PSHY+ Sbjct: 308 YRETSRERSRDRRERGRSREHRIIPSHYI 336 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/37 (29%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 289 HGMQPMRLHCYPRTTLICNGEIYNC--KRLQKQHEFQ 393 HG P++ H + C+G C +K HE Q Sbjct: 275 HGSPPVKQHRSSSASTTCSGHTVRCFTGGPRKSHESQ 311 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,506 Number of Sequences: 438 Number of extensions: 3952 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -