BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP02_FL5_A17 (844 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21650.1 68414.m02710 preprotein translocase secA family prot... 42 5e-04 At2g19540.1 68415.m02283 transducin family protein / WD-40 repea... 41 0.001 At1g10580.1 68414.m01192 transducin family protein / WD-40 repea... 40 0.002 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 40 0.003 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 38 0.011 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 38 0.011 At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 ... 37 0.015 At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) co... 37 0.015 At5g60940.2 68418.m07645 transducin family protein / WD-40 repea... 37 0.019 At5g60940.1 68418.m07644 transducin family protein / WD-40 repea... 37 0.019 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 37 0.019 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 37 0.019 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 37 0.019 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 37 0.019 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 37 0.019 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 36 0.025 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 36 0.025 At1g19750.1 68414.m02469 transducin family protein / WD-40 repea... 36 0.025 At5g56130.1 68418.m07002 transducin family protein / WD-40 repea... 36 0.034 At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta... 36 0.034 At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta... 36 0.034 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 36 0.034 At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pf... 36 0.044 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 36 0.044 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 36 0.044 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 36 0.044 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 35 0.059 At1g73720.1 68414.m08536 transducin family protein / WD-40 repea... 35 0.059 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 35 0.078 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 34 0.10 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 34 0.14 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 33 0.18 At1g69400.2 68414.m07968 transducin family protein / WD-40 repea... 33 0.18 At1g69400.1 68414.m07969 transducin family protein / WD-40 repea... 33 0.18 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 33 0.18 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 33 0.18 At3g45620.1 68416.m04927 transducin family protein / WD-40 repea... 33 0.24 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 33 0.24 At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 ... 33 0.24 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 33 0.24 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 33 0.31 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 33 0.31 At3g49660.1 68416.m05427 transducin family protein / WD-40 repea... 33 0.31 At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 ... 33 0.31 At4g35370.1 68417.m05025 transducin family protein / WD-40 repea... 32 0.41 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 32 0.41 At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 rec... 32 0.41 At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 ... 32 0.55 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 31 0.72 At4g18900.1 68417.m02786 transducin family protein / WD-40 repea... 31 0.72 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 31 0.72 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 31 0.72 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 31 0.72 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 0.72 At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 ... 31 0.96 At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 ... 31 0.96 At5g12920.1 68418.m01482 expressed protein contains 3 weak WD-40... 31 0.96 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 31 1.3 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 31 1.3 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 31 1.3 At4g18905.1 68417.m02787 transducin family protein / WD-40 repea... 31 1.3 At4g04940.1 68417.m00718 transducin family protein / WD-40 repea... 31 1.3 At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ... 30 1.7 At5g14530.1 68418.m01703 transducin family protein / WD-40 repea... 30 1.7 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 30 1.7 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 30 1.7 At5g50970.1 68418.m06321 WD-40 repeat family protein contains Pf... 30 2.2 At5g50120.1 68418.m06207 transducin family protein / WD-40 repea... 30 2.2 At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 pro... 30 2.2 At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 pro... 30 2.2 At4g23890.1 68417.m03436 expressed protein hypothetical protein,... 30 2.2 At4g07410.1 68417.m01136 transducin family protein / WD-40 repea... 30 2.2 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 30 2.2 At2g19230.1 68415.m02245 leucine-rich repeat protein kinase, put... 30 2.2 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 30 2.2 At5g58760.1 68418.m07360 transducin family protein / WD-40 repea... 29 2.9 At5g48850.1 68418.m06043 male sterility MS5 family protein simil... 29 2.9 At5g27080.1 68418.m03231 WD-40 repeat family protein contains 5 ... 29 2.9 At4g03020.1 68417.m00410 transducin family protein / WD-40 repea... 29 2.9 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 29 2.9 At1g80710.1 68414.m09470 transducin family protein / WD-40 repea... 29 2.9 At1g15440.2 68414.m01856 transducin family protein / WD-40 repea... 29 2.9 At1g15440.1 68414.m01855 transducin family protein / WD-40 repea... 29 2.9 At5g37560.1 68418.m04523 zinc finger protein-related contains we... 29 3.9 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 29 3.9 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 29 3.9 At5g08560.1 68418.m01018 transducin family protein / WD-40 repea... 29 3.9 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 29 3.9 At3g13290.1 68416.m01673 transducin family protein / WD-40 repea... 29 3.9 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 29 3.9 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 29 3.9 At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.9 At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 29 5.1 At3g26480.1 68416.m03301 transducin family protein / WD-40 repea... 29 5.1 At1g20540.1 68414.m02559 transducin family protein / WD-40 repea... 29 5.1 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 29 5.1 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 29 5.1 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 28 6.8 At5g43920.1 68418.m05372 transducin family protein / WD-40 repea... 28 6.8 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 28 6.8 At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf... 28 6.8 At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochro... 28 6.8 At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochro... 28 6.8 At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 ... 28 8.9 At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 ... 28 8.9 At2g47790.1 68415.m05965 transducin family protein / WD-40 repea... 28 8.9 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 28 8.9 At2g24680.1 68415.m02947 transcriptional factor B3 family protei... 28 8.9 >At1g21650.1 68414.m02710 preprotein translocase secA family protein contains Pfam profiles: PF01043 SecA protein, amino terminal region, PF00400 WD domain, G-beta repeat, PF00097 zinc finger, C3HC4 type (RING finger) Length = 1579 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/72 (34%), Positives = 38/72 (52%) Frame = +1 Query: 283 IHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYS 462 IH L ++ ++ DN+I+ + L D SL +C + GHK T VV + +LYS Sbjct: 589 IHALAYSEYGHVYTGSGDNTIKAWSLQDGSL--LCTMSGHKSVVSTLVVVN----GVLYS 642 Query: 463 TGLDGLVKLWDI 498 DG V+LW + Sbjct: 643 GSWDGTVRLWSL 654 >At2g19540.1 68415.m02283 transducin family protein / WD-40 repeat family protein contains WD-40 repeats (PF00400); similar to Glutamate-rich WD repeat protein (GRWD) (SP:Q9BQ67)[Homo sapiens] Length = 469 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = +1 Query: 397 GHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEI 549 GH A++ + +SP E+N+ S +DG V +WDIR G S L +K ++ Sbjct: 267 GHT-ASVEDLQWSPAEENVFASCSVDGSVAVWDIRLGKSPALSFKAHNADV 316 >At1g10580.1 68414.m01192 transducin family protein / WD-40 repeat family protein similar to splicing factor hPRP17 (gi|3283220); contains 7 WD-40 repeats (PF00400);similar to ESTs emb|F15435 and dbj|AUO62661 Length = 573 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +1 Query: 397 GHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEY 528 GH + ++ + F PK+ +LL S G+D VK+WD+ G C+ Y Sbjct: 280 GHTKG-VSAIRFFPKQGHLLLSAGMDCKVKIWDVYNSGKCMRTY 322 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 L S D ++ ++++ S + R+ HK + +T V F+P +DN S +DG V++WD Sbjct: 377 LLSSSVDETVRLWRVGSSD--ECIRVFSHK-SFVTCVAFNPVDDNYFISGSIDGKVRIWD 433 Query: 496 I 498 + Sbjct: 434 V 434 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +1 Query: 307 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 486 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 562 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 619 Query: 487 LWDIRAGGSCVLEYKDEEEEI 549 WDI A SCV K ++ Sbjct: 620 FWDINA--SCVRAVKGASTQV 638 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +1 Query: 307 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 486 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 487 LWDIRAGGSCVLEYKDEEEEI 549 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +1 Query: 307 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 486 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 487 LWDIRAGGSCVLEYKDEEEEI 549 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +1 Query: 307 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 486 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 487 LWDIRAGGSCVLEYKDEEEEI 549 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 40/81 (49%) Frame = +1 Query: 307 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 486 S LA S D +I+I+ SD + + + GH A + + F PK+ LL S + ++ Sbjct: 564 STQLATSSFDKTIKIWDASDPG-YFLRTISGHA-APVMSIDFHPKKTELLCSCDSNNDIR 621 Query: 487 LWDIRAGGSCVLEYKDEEEEI 549 WDI A SCV K ++ Sbjct: 622 FWDINA--SCVRAVKGASTQV 640 >At5g63010.1 68418.m07905 WD-40 repeat family protein contains 4 WD-40 repeats (PF00400);low similarity to photomorphogenesis repressor (COP1) GI:2702280 [Arabidopsis thaliana] and COP1 GI:11127996 [Ipomoea nil] Length = 343 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +1 Query: 307 SLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVK 486 S ++ + LSD S + +DS+L V GH + L F NL+Y+ D Sbjct: 131 STSIVVGLSDGSASVVSFTDSNLETVQEWKGH-DFELWTASFDLNNPNLVYTGSDDCKFS 189 Query: 487 LWDIR 501 WDIR Sbjct: 190 CWDIR 194 >At4g32551.1 68417.m04633 WD-40 repeat family protein (LEUNIG) contains seven G-protein beta WD-40 repeats; beta transducin-like protein, Podospora anserina, gb:L28125; contains Pfam profiles PF04503: Single-stranded DNA binding protein, SSDP; PF00400:WD domain, G-beta repeat; identical to cDNA LEUNIG (LEUNIG) GI:11141604 Length = 931 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = +1 Query: 310 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 L LA S D ++ ++ +D+ + + GH + +T + F P +D+L+ S D ++ Sbjct: 706 LRLATSSFDKTVRVWD-ADNKGYSLRTFMGHS-SMVTSLDFHPIKDDLICSCDNDNEIRY 763 Query: 490 WDIRAGGSCVLEYKDEEEEI 549 W I GSC YK +I Sbjct: 764 WSIN-NGSCTRVYKGGSTQI 782 >At5g60940.2 68418.m07645 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 337 Score = 36.7 bits (81), Expect = 0.019 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +1 Query: 289 RLDGTKSLNLAISLSDNSIEIYK-LSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYST 465 R T S+ + S D +I ++ +S + + HG E +T VF+ K+ + S+ Sbjct: 181 RYSSTGSIYITAS-KDGAIRLFDGVSAKCVRSIGNAHGKSE--VTSAVFT-KDQRFVLSS 236 Query: 466 GLDGLVKLWDIRAGGSCVLEYKDEEEEILR 555 G D VKLW+I G V EY + LR Sbjct: 237 GKDSTVKLWEI-GSGRMVKEYLGAKRVKLR 265 >At5g60940.1 68418.m07644 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 429 Score = 36.7 bits (81), Expect = 0.019 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +1 Query: 289 RLDGTKSLNLAISLSDNSIEIYK-LSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYST 465 R T S+ + S D +I ++ +S + + HG E +T VF+ K+ + S+ Sbjct: 273 RYSSTGSIYITAS-KDGAIRLFDGVSAKCVRSIGNAHGKSE--VTSAVFT-KDQRFVLSS 328 Query: 466 GLDGLVKLWDIRAGGSCVLEYKDEEEEILR 555 G D VKLW+I G V EY + LR Sbjct: 329 GKDSTVKLWEI-GSGRMVKEYLGAKRVKLR 357 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 36.7 bits (81), Expect = 0.019 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 513 DNSI+++ L + L + L H ++ + + D L S LD VK+W GG+ Sbjct: 286 DNSIKVWSLDN--LQCIQTLTEHTSVVMSLICW----DQFLLSCSLDNTVKIWAATEGGN 339 Query: 514 CVLEYKDEEE-EILRPYECMDVSCNGIVLCT 603 + Y +EE +L D ++LC+ Sbjct: 340 LEVTYTHKEEYGVLALCGVHDAEAKPVLLCS 370 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 36.7 bits (81), Expect = 0.019 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = +1 Query: 277 SYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLL 456 S+++RL+ T + + + I ++ ++ +S V H + V + + Sbjct: 36 SHVNRLEITPDKHYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNNVMA--VGFQCDAKWM 93 Query: 457 YSTGLDGLVKLWDIRAGGSCVLEYK 531 YS DG VK+WD+RA G C EY+ Sbjct: 94 YSGSEDGTVKIWDLRAPG-CQKEYE 117 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 36.7 bits (81), Expect = 0.019 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 5/99 (5%) Frame = +1 Query: 217 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 387 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWENGWAC 134 Query: 388 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 GH + QVVF+PK+ N S LD +K+W++ Sbjct: 135 TQIFEGHSHYVM-QVVFNPKDTNTFASASLDRTIKIWNL 172 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 36.7 bits (81), Expect = 0.019 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 5/99 (5%) Frame = +1 Query: 217 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 387 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWENGWAC 134 Query: 388 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 GH + QVVF+PK+ N S LD +K+W++ Sbjct: 135 TQIFEGHSHYVM-QVVFNPKDTNTFASASLDRTIKIWNL 172 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 36.7 bits (81), Expect = 0.019 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 5/99 (5%) Frame = +1 Query: 217 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 387 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWENGWAC 134 Query: 388 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 GH + QVVF+PK+ N S LD +K+W++ Sbjct: 135 TQIFEGHSHYVM-QVVFNPKDTNTFASASLDRTIKIWNL 172 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/72 (26%), Positives = 35/72 (48%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 513 D +++I+ +SD S + GH + L + + S G DGL+KLW++ Sbjct: 562 DKTVKIWAISDGSCLKT--FEGHTSSVLRASFIT--DGTQFVSCGADGLLKLWNVNT-SE 616 Query: 514 CVLEYKDEEEEI 549 C+ Y E+++ Sbjct: 617 CIATYDQHEDKV 628 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 397 GHKEATLTQVVFSPKED-NLLYSTGLDGLVKLWDIRA 504 GHK ++ ++F P + N+L S D V++WD+ A Sbjct: 142 GHK-GVVSSILFHPDSNKNILISGSDDATVRVWDLNA 177 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 391 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 L GH++ ++ V +S + +LY+ G DG ++ WDIR G Sbjct: 186 LSGHRDGVMS-VEWSTSSEWVLYTGGCDGAIRFWDIRRAG 224 >At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat family protein similar to Cockayne syndrome complementaion group A proteins (GI:18077663)[Mus musculus] and (SP:Q13216)[Homo sapiens]; confirmed by full-length cDNA GI:15982896 Length = 450 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 391 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 L GH++ ++ V +S + +LY+ G DG ++ WDIR G Sbjct: 186 LSGHRDGVMS-VEWSTSSEWVLYTGGCDGAIRFWDIRRAG 224 >At5g56130.1 68418.m07002 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GI:17225206) [Podospora anserina] Length = 315 Score = 35.9 bits (79), Expect = 0.034 Identities = 38/135 (28%), Positives = 62/135 (45%), Gaps = 2/135 (1%) Frame = +1 Query: 271 LHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDS--SLHQVCRLHGHKEATLTQVVFSPKE 444 +HS +GTK LA D + I+ + S + L GH ++ + Q+ + PK Sbjct: 23 VHSVAWNSNGTK---LASGSVDQTARIWNIEPHGHSKAKDLELKGHTDS-VDQLCWDPKH 78 Query: 445 DNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDD 624 +L+ + D V+LWD R+ G C + + E I Y+ +G + G++ DD Sbjct: 79 SDLVATASGDKSVRLWDARS-GKCTQQVELSGENINITYK-----PDGTHVAVGNR--DD 130 Query: 625 DAYLVFFDXRKPXPL 669 + L D RK PL Sbjct: 131 E--LTILDVRKFKPL 143 >At4g34460.2 68417.m04898 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 315 Score = 35.9 bits (79), Expect = 0.034 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKE-ATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 D + +Y + QV + HG E +T + FS L + +WD G Sbjct: 207 DGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLG- 265 Query: 511 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 VL+ +++ C+ +S +G LCTGS Sbjct: 266 EVVLDLGLQQDSHRNRISCLGLSADGSALCTGS 298 >At4g34460.1 68417.m04899 guanine nucleotide-binding protein beta subunit (GB1) / GTP-binding protein beta subunit (AGB1) / transducin contains 7 WD-40 repeats (PF00400); identical to Guanine nucleotide-binding protein beta subunit.SP:P49177 [Arabidopsis thaliana]; Weiss, CA et al, PNAS 91:9954 (1994) Length = 377 Score = 35.9 bits (79), Expect = 0.034 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 1/93 (1%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKE-ATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 D + +Y + QV + HG E +T + FS L + +WD G Sbjct: 269 DGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLG- 327 Query: 511 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 VL+ +++ C+ +S +G LCTGS Sbjct: 328 EVVLDLGLQQDSHRNRISCLGLSADGSALCTGS 360 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 35.9 bits (79), Expect = 0.034 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 5/99 (5%) Frame = +1 Query: 217 EQMFSKKYKIVTEHAVSLLHS---YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 387 + MF + Y T + + + YI + +L +S SD+ + KL D +C Sbjct: 77 DDMFIRVYNYNTMDKIKVFEAHADYIRCVAVHPTLPYVLSSSDDML--IKLWDWEKGWLC 134 Query: 388 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 GH + QV F+PK+ N S LD +K+W++ Sbjct: 135 TQIFEGHSHYVM-QVTFNPKDTNTFASASLDRTIKIWNL 172 >At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 825 Score = 35.5 bits (78), Expect = 0.044 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = +1 Query: 292 LDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGL 471 L +KS +L S D ++ ++ LS + +V H + +T + F+P +DN S L Sbjct: 474 LSWSKSQHLLSSSMDKTVRLWDLSSKTCLKV---FSHSDY-VTCIQFNPVDDNYFISGSL 529 Query: 472 DGLVKLWDI 498 D V++W I Sbjct: 530 DAKVRIWSI 538 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 35.5 bits (78), Expect = 0.044 Identities = 30/98 (30%), Positives = 47/98 (47%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA SD +++I+ + Q + GH T + F+P + + S GLD +VK+WD Sbjct: 115 LASGSSDANLKIWDIRKKGCIQTYK--GHSRGIST-IRFTP-DGRWVVSGGLDNVVKVWD 170 Query: 496 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 + A G + E+K E P +D +L TGS Sbjct: 171 LTA-GKLLHEFKFHE----GPIRSLDFHPLEFLLATGS 203 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 35.5 bits (78), Expect = 0.044 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 5/99 (5%) Frame = +1 Query: 217 EQMFSKKYKIVTEHAVSLL--HS-YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVC 387 + M+ + Y T V + HS YI + +L +S SD+ + KL D C Sbjct: 77 DDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDDML--IKLWDWEKGWAC 134 Query: 388 R--LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 GH + QV F+PK+ N S LD +K+W++ Sbjct: 135 TQIFEGHSHYVM-QVTFNPKDTNTFASASLDRTIKIWNL 172 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 35.5 bits (78), Expect = 0.044 Identities = 30/98 (30%), Positives = 45/98 (45%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA SD ++ ++ Q + GH T + FSP + + S GLD +VK+WD Sbjct: 64 LASGSSDTNLRVWDTRKKGCIQTYK--GHTRGIST-IEFSP-DGRWVVSGGLDNVVKVWD 119 Query: 496 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 + A G + E+K E P +D +L TGS Sbjct: 120 LTA-GKLLHEFKCHE----GPIRSLDFHPLEFLLATGS 152 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 35.1 bits (77), Expect = 0.059 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 319 AISLSDNSIEIYKLSDS-SLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 ++ +S ++ KL D+ S ++C LHGHK L+ V + N L + D ++KL+D Sbjct: 281 SLLVSGGKDQLVKLWDTRSGRELCSLHGHKNIVLS--VKWNQNGNWLLTASKDQIIKLYD 338 Query: 496 IR 501 IR Sbjct: 339 IR 340 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/88 (31%), Positives = 40/88 (45%) Frame = +1 Query: 448 NLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQLVDDD 627 +LL S G D LVKLWD R+G + + +L + + NG L T S+ D Sbjct: 281 SLLVSGGKDQLVKLWDTRSGRE-LCSLHGHKNIVL----SVKWNQNGNWLLTASK----D 331 Query: 628 AYLVFFDXRKPXPLGGYWNSHTDDVTXI 711 + +D R L + HT DVT + Sbjct: 332 QIIKLYDIRTMKELQSF-RGHTKDVTSL 358 >At1g73720.1 68414.m08536 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Will die slowly protein (SP:Q9V3J8)[Drosophila melanogaster] Length = 511 Score = 35.1 bits (77), Expect = 0.059 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +1 Query: 430 FSPKEDNLLYSTGLDGLVKLWDIRAGG-SCVLEYKDEEEEILR--PYECMDVSCNGIVLC 600 FSP + L S+ +DG +++WD +G L+Y+ +E ++ P C+D S + +L Sbjct: 221 FSP-DGQFLASSSVDGFIEVWDYISGKLKKDLQYQADESFMMHDDPVLCIDFSRDSEMLA 279 Query: 601 TGSQ 612 +GSQ Sbjct: 280 SGSQ 283 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 34.7 bits (76), Expect = 0.078 Identities = 20/61 (32%), Positives = 34/61 (55%) Frame = +1 Query: 367 SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEE 546 S+ + V +++GHK T + FSP + L + G DG+VK+W I S + + ++E Sbjct: 186 SAAYMVQKINGHKGKIWT-LKFSP-DGKYLATGGEDGVVKIWRITLSDSLLASFLRQQEP 243 Query: 547 I 549 I Sbjct: 244 I 244 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRL-HGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 LA+SL++NS+E Y L S + + H + + V S EDN L + VK+W Sbjct: 375 LALSLNNNSLEFYSLKSSENAKTVTIEHQGHRSDVRSVTLS--EDNTLLMSTSHSEVKIW 432 Query: 493 DIRAGGSCV 519 + + GSC+ Sbjct: 433 N-PSTGSCL 440 Score = 28.3 bits (60), Expect = 6.8 Identities = 26/92 (28%), Positives = 39/92 (42%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 513 D +++I+ L H+ HG + V + + L+S G D LVK WD Sbjct: 603 DKNLKIWGLDFGDCHKSIFAHGDSVMGVKFV----RNTHYLFSIGKDRLVKYWDADK-FE 657 Query: 514 CVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 +L + EI C+ +S G L TGS Sbjct: 658 HLLTLEGHHAEIW----CLAISNRGDFLVTGS 685 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 33.9 bits (74), Expect = 0.14 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 1/89 (1%) Frame = +1 Query: 394 HGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMD 573 HGH++ T+ V FSP S G D + LWD R G + V + + + L C+D Sbjct: 289 HGHED-TVEDVAFSPTSAQEFCSVGDDSCLILWDARTGTNPVTKVEKAHDADL---HCVD 344 Query: 574 VS-CNGIVLCTGSQLVDDDAYLVFFDXRK 657 + + ++ TGS D + FD RK Sbjct: 345 WNPHDDNLILTGSA----DNTVRLFDRRK 369 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Frame = +1 Query: 331 SDNSIEIY---KLSDSSLHQ-VCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 +DN++ ++ KL+ + + + + GHK A L V +SP + ++ S+ DGL+ +WD Sbjct: 358 ADNTVRLFDRRKLTANGVGSPIYKFEGHKAAVLC-VQWSPDKSSVFGSSAEDGLLNIWD 415 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 33.5 bits (73), Expect = 0.18 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 1/90 (1%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 513 D +I+++ L + L + L H ++ + + D L S LD VK+W GG+ Sbjct: 293 DKTIKVWSLDN--LQCIQTLTDHSSVVMSLICW----DQFLLSCSLDNTVKIWAAIEGGN 346 Query: 514 CVLEYKDEEEE-ILRPYECMDVSCNGIVLC 600 + Y +EE +L D ++LC Sbjct: 347 LEVTYTHKEEHGVLALCGVHDAEAKPVLLC 376 >At1g69400.2 68414.m07968 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 272 Score = 33.5 bits (73), Expect = 0.18 Identities = 27/95 (28%), Positives = 46/95 (48%) Frame = +1 Query: 331 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 SD I Y L+ ++ + R H + + T +V+S ++ ++ STG D +K WD R Sbjct: 73 SDGFIRRYDLNAGTVDTIGR---HDDIS-TSIVYSYEKGEVI-STGFDEKIKFWDTRQRE 127 Query: 511 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQL 615 S V D + C+ VS N +V+C + + Sbjct: 128 SLVFS-TDAGGAV----GCVTVSGNNLVVCVDASM 157 >At1g69400.1 68414.m07969 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 314 Score = 33.5 bits (73), Expect = 0.18 Identities = 27/95 (28%), Positives = 46/95 (48%) Frame = +1 Query: 331 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 SD I Y L+ ++ + R H + + T +V+S ++ ++ STG D +K WD R Sbjct: 73 SDGFIRRYDLNAGTVDTIGR---HDDIS-TSIVYSYEKGEVI-STGFDEKIKFWDTRQRE 127 Query: 511 SCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQL 615 S V D + C+ VS N +V+C + + Sbjct: 128 SLVFS-TDAGGAV----GCVTVSGNNLVVCVDASM 157 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 33.5 bits (73), Expect = 0.18 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 415 LTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 +T V F+P +DN S +DG V++WD+ Sbjct: 365 VTCVAFNPVDDNYFISGSIDGKVRIWDV 392 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 33.5 bits (73), Expect = 0.18 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 415 LTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 +T V F+P +DN S +DG V++WD+ Sbjct: 365 VTCVAFNPVDDNYFISGSIDGKVRIWDV 392 >At3g45620.1 68416.m04927 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats; similar to PC326 protein (GI:200241) (PIR2:S37694) [Mus musculus];Human (H326) translated mRNA - Homo sapiens, EMBL:HS06631 Length = 481 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/76 (23%), Positives = 38/76 (50%) Frame = +1 Query: 301 TKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGL 480 T + S +D + + ++ ++ + RL G + ++ P + N+ YS G DG Sbjct: 110 TDDRTIITSGADGQVRLGQILENGKVETKRL-GRHHGRVYKLAVLPGDPNVFYSCGEDGF 168 Query: 481 VKLWDIRAGGSCVLEY 528 V+ +DIR+ + ++ Y Sbjct: 169 VQHFDIRSNSATMVLY 184 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 33.1 bits (72), Expect = 0.24 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 301 TKSLNLAISLSDNSIEIYKLSDSSLHQVC-RLHGHKEATLTQVVFSPKEDNLLYSTGLDG 477 +KS +L S D ++ ++ LS Q C ++ H + +T + F+P +D S LD Sbjct: 522 SKSQHLLSSSMDKTVRLWNLSS----QTCLKVFSHSDY-VTCIQFNPVDDRYFISGSLDA 576 Query: 478 LVKLWDI 498 V++W I Sbjct: 577 KVRVWSI 583 >At2g37670.1 68415.m04620 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similiar to rab11 binding protein (GI:4512103) [Bos taurus] Length = 903 Score = 33.1 bits (72), Expect = 0.24 Identities = 22/86 (25%), Positives = 42/86 (48%) Frame = +1 Query: 292 LDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGL 471 L +KS L S D ++ ++ + + +L H + +T + FSP ++N S L Sbjct: 512 LSWSKSQLLLSSSMDKTVRLWDIETKTC---LKLFAHNDY-VTCIQFSPVDENYFLSGSL 567 Query: 472 DGLVKLWDIRAGGSCVLEYKDEEEEI 549 D +++W I+ V+E+ D E + Sbjct: 568 DAKIRIWSIQ--DRHVVEWSDLHEMV 591 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 33.1 bits (72), Expect = 0.24 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 507 D +++++ LS+ L L GH T V SP + +L S G DG+V LWD+ G Sbjct: 173 DKTVKVWNLSNCKLRST--LAGHTGYVST-VAVSP-DGSLCASGGKDGVVLLWDLAEG 226 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 32.7 bits (71), Expect = 0.31 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = +1 Query: 313 NLAISLS-DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 N +S S D ++ ++K+ + V + + +T V F+P +N S +DG V++ Sbjct: 340 NYLLSASMDKTVRLWKVGSNDCLGVFAHNSY----VTSVQFNPVNENYFMSGSIDGKVRI 395 Query: 490 WDIRAGGSCVLEYKDEEEEI 549 W+I G V+++ D ++ I Sbjct: 396 WNI--SGCSVVDWADLKDII 413 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 32.7 bits (71), Expect = 0.31 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = +1 Query: 394 HGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMD 573 +GHK+ T+ V F P S G D + LWD R G S ++ + + L C+D Sbjct: 278 NGHKD-TVEDVAFCPSSAQEFCSVGDDSCLMLWDARTGTSPAMKVEKAHDADL---HCVD 333 Query: 574 VS--CNGIVLCTGS 609 + N ++L TGS Sbjct: 334 WNPHDNNLIL-TGS 346 Score = 31.5 bits (68), Expect = 0.72 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = +1 Query: 331 SDNSIEIY---KLSDSSLHQ-VCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 +DN++ ++ L+ + + V + GH+ A L V +SP + ++ S+ DGL+ +WD Sbjct: 347 ADNTVRVFDRRNLTSNGVGSPVYKFEGHRAAVLC-VQWSPDKSSVFGSSAEDGLLNIWD 404 >At3g49660.1 68416.m05427 transducin family protein / WD-40 repeat family protein beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 32.7 bits (71), Expect = 0.31 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 1/100 (1%) Frame = +1 Query: 313 NLAISLS-DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 N+ +S S D ++ I+ ++ +V H +T V F+ ++ +L+ S+ DGL ++ Sbjct: 126 NMIVSGSFDETVRIWDVTTGKCLKVLPAHSDP---VTAVDFN-RDGSLIVSSSYDGLCRI 181 Query: 490 WDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 WD G CV D+E P + S NG + G+ Sbjct: 182 WD-SGTGHCVKTLIDDENP---PVSFVRFSPNGKFILVGT 217 >At2g16780.1 68415.m01924 WD-40 repeat protein (MSI2) contains 5 WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI2 (SP:O22468) [Arabidopsis thaliana] WD-40 repeats (PF0400); Length = 415 Score = 32.7 bits (71), Expect = 0.31 Identities = 33/117 (28%), Positives = 50/117 (42%) Frame = +1 Query: 364 DSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEE 543 D L+ + GH E+ + V + K +NL S G DG + +WD R + K E Sbjct: 204 DKVLNAMFVYEGH-ESAIADVSWHMKNENLFGSAGEDGRLVIWDTRT-NQMQHQVKVHER 261 Query: 544 EILRPYECMDVSCNGIVLCTGSQLVDDDAYLVFFDXRKPXPLGGYWNSHTDDVTXIK 714 E+ Y + N VL T S D+ + FD RK +SH +V ++ Sbjct: 262 EV--NYLSFN-PFNEWVLATAS----SDSTVALFDLRKLNAPLHVMSSHEGEVFQVE 311 >At4g35370.1 68417.m05025 transducin family protein / WD-40 repeat family protein contains 4 (3 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 414 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +1 Query: 313 NLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 + +SL D +++ + S L +H H ++ ++ + ++ NLL + D VKLW Sbjct: 315 SFVVSLKDGTVKGFDTRASDLSPSFIIHAH-DSEVSSISYNIHAPNLLATGSADESVKLW 373 Query: 493 DI 498 D+ Sbjct: 374 DL 375 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 32.3 bits (70), Expect = 0.41 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 507 D +++++ L + L L GH L V SP + +L S G DG++ LWD+ G Sbjct: 172 DKTVKVWNLQNCKLRNT--LAGHS-GYLNTVAVSP-DGSLCASGGKDGVILLWDLAEG 225 >At1g29260.1 68414.m03578 peroxisomal targeting signal type 2 receptor (PEX7) identical to peroxisomal targeting signal type 2 receptor (Pex7p) (GI:9502414) [Arabidopsis thaliana]; WD-40 repeat protein family member; contains 6 WD-40 repeats (PF00400); similar to peroxismal targeting signal 2 receptor (PTS2R) (Peroxin-7) (PEX7)(SP:O00628) [Homo sapiens] Length = 317 Score = 32.3 bits (70), Expect = 0.41 Identities = 28/97 (28%), Positives = 45/97 (46%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA S D +++++ + + + L+GH A + +V FSP +L+ S D V LWD Sbjct: 208 LATSSVDKTVKVWDVRSYRV-PLAVLNGHGYA-VRKVKFSPHRRSLIASCSYDMSVCLWD 265 Query: 496 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTG 606 + V Y D E + M V G++ TG Sbjct: 266 YMVEDALVGRY-DHHTEFAVGID-MSVLVEGLMASTG 300 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/63 (20%), Positives = 35/63 (55%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 513 D++++++ + + + + H + + Q V++PK ++ S D +++WD+R GS Sbjct: 128 DDTVKLWAMDRPASVRTFKEHAY---CVYQAVWNPKHGDVFASASGDCTLRIWDVREPGS 184 Query: 514 CVL 522 ++ Sbjct: 185 TMI 187 >At5g02430.1 68418.m00167 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); rab11 binding protein, Bos taurus, EMBL:AF117897 Length = 905 Score = 31.9 bits (69), Expect = 0.55 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%) Frame = +1 Query: 277 SYIHRLDGTKSLNLAIS---LSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKED 447 S+ LD L+ + S LS + + +L D +L H + +T V F+P ++ Sbjct: 514 SFTGHLDDVLDLSWSRSQLLLSSSMDKTVRLWDIETQSCLKLFAHNDY-VTCVQFNPLDE 572 Query: 448 NLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEI 549 + S LD +++W+I V+E+ D +E + Sbjct: 573 DYFISGSLDAKIRIWNI--SNRQVVEWNDLKEMV 604 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 31.5 bits (68), Expect = 0.72 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 4/100 (4%) Frame = +1 Query: 424 VVFSPKEDNLLYSTGLDGLVKLWD--IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVL 597 V FSP + ++ S G+D + +D R SC+ Y+ P+ + NG +L Sbjct: 228 VCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCI-AYE-------APFSSLAFGDNGYIL 279 Query: 598 CTGSQLVDDDAYLVFFDXR-KPXPLGG-YWNSHTDDVTXI 711 G+ + +VF+D R KP P+ + S+++DVT + Sbjct: 280 VAGT----SNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSL 315 >At4g18900.1 68417.m02786 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 461 Score = 31.5 bits (68), Expect = 0.72 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = +1 Query: 313 NLAISLSDNSIEIYKLSDSSL-----HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDG 477 + +SL D +++ + + +S+ + ++GH EA T V ++ NLL + D Sbjct: 334 SFVVSLEDGTVKGFDVRQASISASESNPSFTINGHDEAA-TSVSYNISAPNLLATGSKDR 392 Query: 478 LVKLWDI 498 VKLWD+ Sbjct: 393 TVKLWDL 399 Score = 31.5 bits (68), Expect = 0.72 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA D +++++ LS++ + H L + FSP LL G+ G +KLWD Sbjct: 385 LATGSKDRTVKLWDLSNNEPSCIAT-HNPNAGGLFFIAFSPDNPFLLAMGGVMGELKLWD 443 Query: 496 IRAGGSCVLEYKDEE 540 + + Y E Sbjct: 444 TLSDTNVSSRYGSRE 458 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 31.5 bits (68), Expect = 0.72 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 334 DNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 507 D +++++ L + L L GH L V SP + +L S G DG++ LWD+ G Sbjct: 172 DKTVKVWNLQNCKLRN--SLVGHS-GYLNTVAVSP-DGSLCASGGKDGVILLWDLAEG 225 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 31.5 bits (68), Expect = 0.72 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 L +S + + I +Y S L Q + H P + + + G D L+K+WD Sbjct: 424 LGVSFTKHLIHVYAYQGSDLRQHLEIDAHVGCVNDLAFAHPNKQMCVVTCGDDKLIKVWD 483 Query: 496 I 498 + Sbjct: 484 L 484 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 346 EIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKED-NLLYSTGLDGLVKLW 492 ++ K+ D S ++ GH EA + + KE+ ++ST LDG +K W Sbjct: 477 KLIKVWDLSGKKLFTFEGH-EAPVYSICPHQKENIQFIFSTALDGKIKAW 525 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 31.5 bits (68), Expect = 0.72 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 1/115 (0%) Frame = +1 Query: 268 LLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKED 447 ++ S R DG +L A LS ++++ + + + R H + + V P +D Sbjct: 95 VVSSVCFRSDG--ALFAACDLS-GVVQVFDIKERMALRTLRSH----SAPARFVKYPVQD 147 Query: 448 NL-LYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 L L S G DG+VK WD+ G+ V+ ++ +R +C V N +L TGS Sbjct: 148 KLHLVSGGDDGVVKYWDV--AGATVISDLLGHKDYVRCGDCSPV--NDSMLVTGS 198 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 31.5 bits (68), Expect = 0.72 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 451 LLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQ 612 L S GLD L ++WD+R G S +L ++ ++P ++ S NG L +G + Sbjct: 395 LAASCGLDSLARVWDLRTGRS-ILVFQGH----IKPVFSVNFSPNGYHLASGGE 443 >At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; similar to "Will die slowly" protein, Drosophia; putative cdc20 protein - Arabidopsis thaliana, EMBL:AF029262 Length = 411 Score = 31.1 bits (67), Expect = 0.96 Identities = 21/80 (26%), Positives = 42/80 (52%) Frame = +1 Query: 310 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 L+LAI L ++ ++++ + QV L G E+ + + ++ +++L + G+DG + Sbjct: 147 LDLAIGLDNSEVQLWDCVSN--RQVRTLRGGHESRVGSLAWN---NHILTTGGMDGKIVN 201 Query: 490 WDIRAGGSCVLEYKDEEEEI 549 D+R S V Y EE+ Sbjct: 202 NDVRIRSSIVETYLGHTEEV 221 >At5g26900.1 68418.m03208 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; WD-repeat protein, carrot, PIR:T14352 Length = 444 Score = 31.1 bits (67), Expect = 0.96 Identities = 20/80 (25%), Positives = 42/80 (52%) Frame = +1 Query: 310 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 L+LA+ L ++ ++++ + QV L G E+ + + + ++++L + G+DG + Sbjct: 181 LDLAVGLDNSEVQLWDCVSN--RQVRTLRGGHESRVGSLAW---DNHILTTGGMDGKIVN 235 Query: 490 WDIRAGGSCVLEYKDEEEEI 549 D+R S V Y EE+ Sbjct: 236 NDVRIRSSIVETYLGHTEEV 255 >At5g12920.1 68418.m01482 expressed protein contains 3 weak WD-40 repeats (PF00400); low similarity to MEK kinase alpha (GI:4028547); transcriptional repressor TUP1 (GI:3406654) [Dictyostelium discoideum]; Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (TGF-beta receptor interacting protein 1) (TRIP-1) (SP:Q38884) [Arabidopsis thaliana] Length = 442 Score = 31.1 bits (67), Expect = 0.96 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 415 LTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILR 555 L+ V + ED+ ++S G+V +WD RAG S +E + + ++ Sbjct: 153 LSDVAITSDEDSRIFSPDTLGMVHVWDRRAGVSPCIELSTDRYDSIK 199 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 +A + +I+++ L ++ + V L GH+ ++ V F P + S LD +K+WD Sbjct: 74 VAAGAASGTIKLWDLEEAKI--VRTLTGHRSNCIS-VDFHPFGE-FFASGSLDTNLKIWD 129 Query: 496 IRAGGSCVLEYK 531 IR G C+ YK Sbjct: 130 IRKKG-CIHTYK 140 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/72 (30%), Positives = 38/72 (52%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 +A + +I+++ L ++ + V L GH+ ++ V F P + S LD +K+WD Sbjct: 74 VAAGAASGTIKLWDLEEAKI--VRTLTGHRSNCIS-VDFHPFGE-FFASGSLDTNLKIWD 129 Query: 496 IRAGGSCVLEYK 531 IR G C+ YK Sbjct: 130 IRKKG-CIHTYK 140 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 30.7 bits (66), Expect = 1.3 Identities = 24/79 (30%), Positives = 41/79 (51%) Frame = +1 Query: 295 DGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLD 474 D ++ L +A + +I+++ L ++ + V L GH+ + V F P + S LD Sbjct: 161 DASEGL-VAAGAASGTIKLWDLEEAKV--VRTLTGHR-SNCVSVNFHPFGE-FFASGSLD 215 Query: 475 GLVKLWDIRAGGSCVLEYK 531 +K+WDIR G C+ YK Sbjct: 216 TNLKIWDIRKKG-CIHTYK 233 >At4g18905.1 68417.m02787 transducin family protein / WD-40 repeat family protein contains 5 (4 significant) WD-40 repeats; similar to periodic tryptophan protein 1 homolog (Keratinocyte protein IEF SSP 9502) (PWP1)(SP:Q13610) (PIR2:I39360) [Homo sapiens] Length = 494 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 8/81 (9%) Frame = +1 Query: 313 NLAISLSDNSIEIYKL------SDSSLHQVCRLHGH-KEATLTQVVFSPKEDNLLYSTGL 471 + +SL D +++ + + SDS L+ + H ++ ++ + ++ NLL + + Sbjct: 366 SFVVSLEDGTVKGFDIRAAQSGSDSDLNPTYTIQAHAQDRGVSSISYNISTPNLLATGSM 425 Query: 472 DGLVKLWDIRAG-GSCVLEYK 531 D VKLWD+ SC+ ++ Sbjct: 426 DKSVKLWDLSNNEPSCIATHQ 446 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +1 Query: 400 HKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEI 549 H E+ L + ++ + N+L S D VK+WD+ A G+C + + +E+ Sbjct: 264 HTESVLG-LAWNKEFRNILASASADKKVKVWDV-ATGTCKITMEHHTKEV 311 >At4g04940.1 68417.m00718 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats Length = 910 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +1 Query: 265 SLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKE 444 SL+ HR++G LA D I +Y + +L V GH + +T + FS ++ Sbjct: 517 SLVKIVYHRVNGL----LATVADDFVIRLYDVV--TLKMVREFRGHTDR-ITDLCFS-ED 568 Query: 445 DNLLYSTGLDGLVKLWDI 498 + S+ +DG +++WD+ Sbjct: 569 GKWVISSSMDGSLRIWDV 586 >At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to pre-mRNA splicing factor PRP17 (SP:O60508) [Homo sapiens] Length = 457 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 391 LHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDI 498 L GH +A +T + +S +LL S GLDG V +W++ Sbjct: 156 LTGHTKA-VTAIDWSTSHVHLLASAGLDGAVYVWNV 190 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 403 KEATLTQVV-FSPKEDNLLYSTGLDGLVKLWDIRA 504 KE + VV F P N+ S G G ++LWDIRA Sbjct: 244 KEDEVVGVVKFHPDNCNVFLSGGSKGSLRLWDIRA 278 >At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat family protein similar to Will die slowly protein (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak) Length = 330 Score = 30.3 bits (65), Expect = 1.7 Identities = 26/84 (30%), Positives = 39/84 (46%) Frame = +1 Query: 250 TEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVV 429 T H SL+ S + L+ T +S+ DN I Y GHK+ ++ + Sbjct: 75 THHPSSLICSSRYNLESTGESLRYLSMYDNRILRY------------FKGHKDRVVS-LC 121 Query: 430 FSPKEDNLLYSTGLDGLVKLWDIR 501 SP D+ + S LD V+LWD+R Sbjct: 122 MSPINDSFM-SGSLDRSVRLWDLR 144 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 L + D +I+++ + ++ V L GH T+ + P +LL S DG LWD Sbjct: 143 LLTASGDQTIKVWDVEENKCTGV--LIGHT-GTVKSMCSHPTNSDLLVSGSRDGCFALWD 199 Query: 496 IRAGGS 513 +R S Sbjct: 200 LRCKSS 205 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 30.3 bits (65), Expect = 1.7 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Frame = +1 Query: 241 KIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQ-VCRLHGHKEATL 417 KI T H+ +H + G + +A + SD +I+I +S+S Q + L GH+ + Sbjct: 5 KIETGHS-DTIHDVVMDYYGKR---VATASSDCTIKITGVSNSGGSQHLATLTGHR-GPV 59 Query: 418 TQVVFS-PKEDNLLYSTGLDGLVKLW 492 QV ++ PK +LL S DG + LW Sbjct: 60 WQVAWAHPKFGSLLASCSYDGQIILW 85 >At5g50970.1 68418.m06321 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 512 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +1 Query: 376 HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 507 H ++ + L ++ P + L ++ LDG+V LW ++ G Sbjct: 186 HTSNQISSQHKRKLRSLILCPVNEQLFATSSLDGMVSLWQLQPG 229 >At5g50120.1 68418.m06207 transducin family protein / WD-40 repeat family protein Similar to En/Spm-like transposon protein (gi:2739374)[Arabidopsis thaliana]; similar to GTP-binding regulatory protein and WD-repeat protein; contains 7 WD-40 repeats Length = 388 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +1 Query: 376 HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVL--EYKDEEEEI 549 H + + + + + S +LL+S G DG + +W+ GG V+ + E + Sbjct: 249 HSLVAILSEHNSGINALALSGTNGSLLHSGGSDGSILVWERDDGGDIVVVGMLRGHTESV 308 Query: 550 LRPYECMDVSCNG 588 L D+ C+G Sbjct: 309 LCLAVVSDILCSG 321 >At5g49200.1 68418.m06089 WD-40 repeat family protein / zfwd4 protein (ZFWD4) contains 6 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd4 protein (GI:12057170) [Arabidopsis thaliana] Length = 419 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 373 LHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCV 519 L V L GH + + + P+ + L+S +DG +++WD + G CV Sbjct: 121 LAMVASLEGHNKEL--KGIALPEGSDKLFSVSIDGTLRVWDCNS-GQCV 166 >At5g40880.1 68418.m04964 WD-40 repeat family protein / zfwd3 protein (ZFWD3) contains 5 WD-40 repeats (PF00400); contains Zinc finger C-x8-C-x5-C-x3-H type domain (PF00642); identical to zfwd3 protein (GP:12057168) {Arabidopsis thaliana} Length = 472 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = +1 Query: 283 IHRLDGTKSLNLAISLSDNSIEIYKLSDSS---LHQVCRLHGHKEATLTQVVFSPKEDNL 453 +H + + A S SI ++K +DS + L GH +T V + + Sbjct: 269 VHAMTAANGMLFA-GTSSGSILVWKATDSESDPFKYLTSLEGHHSGEVTCFVVGGE---V 324 Query: 454 LYSTGLDGLVKLWDI 498 LYS +D +K+WD+ Sbjct: 325 LYSGSVDKTIKVWDL 339 >At4g23890.1 68417.m03436 expressed protein hypothetical protein, Synechocystis sp., PIR:S76577 Length = 250 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 400 HKEATLTQVVFSP-KEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYE 564 H+ +T+ + VF P K+ + LY G LW++ G K E+E+ R E Sbjct: 25 HQFSTVNRSVFPPPKQQSKLYQVKAMGKFNLWEVMGGRGLCNGEKGIEKELQRNIE 80 >At4g07410.1 68417.m01136 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400) (2 weak); similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina} Length = 815 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRL--HGHKEATLTQVVF--SPK---EDNLLYSTGLD 474 +A + D S+EI+ +S ++ C+L HG + ++ + + SP L+S+ +D Sbjct: 28 VAAAREDGSLEIWLVSPGAVGWHCQLTIHGDPNSRISSLAWCCSPSIGLPSGRLFSSSID 87 Query: 475 GLVKLWDI 498 G + WD+ Sbjct: 88 GSISEWDL 95 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA + D + +Y++S+ R V +SP + ++S DGL++ WD Sbjct: 168 LAAACDDGCVRLYRISNLEKLTYYRSLPRVSGRALSVTWSP-DAKRIFSGSSDGLIRCWD 226 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/84 (23%), Positives = 38/84 (45%) Frame = +1 Query: 280 YIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLY 459 +++RL+ T ++ + I ++ L + H R + V F +++Y Sbjct: 42 HVNRLELTPEKGKLVAACNPHIRLFDLRSYNPHIPVRNFVSHTKNVMAVGFQ-YTGHMMY 100 Query: 460 STGLDGLVKLWDIRAGGSCVLEYK 531 S DG VK+WD+R C E++ Sbjct: 101 SGSEDGSVKIWDLRV-RECQREFR 123 >At2g19230.1 68415.m02245 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 877 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +1 Query: 349 IYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLV--KLWDIRAGGSCVL 522 IY L +H VC + + V+ N +Y T D L+ + WD+ A G Sbjct: 152 IYTLRSDKVH-VCLVDKERGTPFLSVLELRLLKNNIYETASDSLMLYRRWDLGATGDLPA 210 Query: 523 EYKDE 537 YKD+ Sbjct: 211 RYKDD 215 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 376 HQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 +++ L GHKE +T VVFS +D L + D K+W Sbjct: 97 NKIVVLKGHKEH-VTDVVFSSVDDECLATASTDRTEKIW 134 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = +1 Query: 460 STGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGSQ 612 S+G D L ++WD+R + +L ++ +++L +D S NG L +G + Sbjct: 147 SSGFDSLARVWDLRTARN-ILIFQGHIKQVL----SVDFSPNGYHLASGGE 192 >At5g58760.1 68418.m07360 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); damage-specific DNA binding protein 2 (GI:10798819) [Homo sapiens] Length = 557 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 430 FSPKEDNLLYSTGLDGLVKLWDIRAGGSCVL 522 FSP D+++YS DG + D+ G S L Sbjct: 223 FSPTNDDMVYSASSDGTIGYTDLETGTSSTL 253 >At5g48850.1 68418.m06043 male sterility MS5 family protein similar to male sterility MS5 [Arabidopsis thaliana] GI:3859112; contains Pfam profile PF00515 TPR Domain Length = 306 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -3 Query: 149 SSTFFKSKNLPMKSLISTVRHLIVC 75 +ST FKSK LP+ IS+ R+ +VC Sbjct: 282 TSTSFKSKRLPIFEQISSFRNTLVC 306 >At5g27080.1 68418.m03231 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; Length = 466 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/80 (25%), Positives = 42/80 (52%) Frame = +1 Query: 310 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 L+LA+ L ++ ++++ + QV L G E+ + + ++ +++L + G+DG + Sbjct: 178 LDLAVGLDNSEVQLWDFVSN--RQVRTLIGGHESRVGSLAWN---NHILTTGGMDGKIVN 232 Query: 490 WDIRAGGSCVLEYKDEEEEI 549 D+R S V Y EE+ Sbjct: 233 NDVRIRSSIVGTYLGHTEEV 252 >At4g03020.1 68417.m00410 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to L. erythrorhizon LEC14B, GenBank accession number Q40153 Length = 493 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +1 Query: 331 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIR 501 SD+SI +Y L + + R H T V F+ + NL+ S D L K+WD R Sbjct: 249 SDDSIYVYDLEANRVS--LRTVAHTSDVNT-VCFADESGNLILSGSDDNLCKVWDRR 302 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDS--SLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 +A + D SI+I+ L S + H + +T V FS + +L S DG +K+ Sbjct: 342 IAGGVGDGSIQIWSLKPGWGSRPDIYVGKAHTD-DITSVKFS-SDGRILLSRSFDGSLKV 399 Query: 490 WDIR 501 WD+R Sbjct: 400 WDLR 403 >At1g80710.1 68414.m09470 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); similar to damage-specific DNA-binding protein 2 (DDB2) [Mus musculus] Length = 516 Score = 29.5 bits (63), Expect = 2.9 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +1 Query: 406 EATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGS 513 E + + F+P+ +++ ++ DG LWD+R+ G+ Sbjct: 348 ERRINSIDFNPQNPHVMATSSTDGTACLWDLRSMGA 383 >At1g15440.2 68414.m01856 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 860 Score = 29.5 bits (63), Expect = 2.9 Identities = 23/98 (23%), Positives = 40/98 (40%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA DN ++++ + + H + +T + F +LL S LDG V+ WD Sbjct: 364 LATGADDNKVKVWNVMSGTCFITFTEHTN---AVTALHFMADNHSLL-SASLDGTVRAWD 419 Query: 496 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 + YK R + + +G V+C G+ Sbjct: 420 FKR----YKNYKTYTTPTPRQFVSLTADPSGDVVCAGT 453 >At1g15440.1 68414.m01855 transducin family protein / WD-40 repeat family protein Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains Length = 900 Score = 29.5 bits (63), Expect = 2.9 Identities = 23/98 (23%), Positives = 40/98 (40%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA DN ++++ + + H + +T + F +LL S LDG V+ WD Sbjct: 404 LATGADDNKVKVWNVMSGTCFITFTEHTN---AVTALHFMADNHSLL-SASLDGTVRAWD 459 Query: 496 IRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 + YK R + + +G V+C G+ Sbjct: 460 FKR----YKNYKTYTTPTPRQFVSLTADPSGDVVCAGT 493 >At5g37560.1 68418.m04523 zinc finger protein-related contains weak similarity to zinc fingers and Pfam:PF01485 IBR domain Length = 408 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +1 Query: 373 LHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEEIL 552 L +V RL G +T T V+ + ++DN +D LVK + + K + E +L Sbjct: 120 LEEVQRLRGRLASTGT-VLVATRDDNFALRLAIDALVKATQEKPLTCSICSDKTDAEHML 178 Query: 553 RPYECMDVSC 582 +C+ C Sbjct: 179 LNDKCLHRHC 188 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +1 Query: 301 TKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGL 480 +K+ L + DNS+ ++++ + H +T V F+P +D+ S +DG Sbjct: 365 SKNNRLLSASVDNSVRLWQIG---CEDCLGIFSHNNY-VTSVQFNPVDDDHFISGSIDGK 420 Query: 481 VKLW 492 V++W Sbjct: 421 VRIW 424 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +1 Query: 301 TKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGL 480 +K+ L + DNS+ ++++ + H +T V F+P +D+ S +DG Sbjct: 365 SKNNRLLSASVDNSVRLWQIG---CEDCLGIFSHNNY-VTSVQFNPVDDDHFISGSIDGK 420 Query: 481 VKLW 492 V++W Sbjct: 421 VRIW 424 >At5g08560.1 68418.m01018 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 589 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = +1 Query: 298 GTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDG 477 G K +A D+ + I+ S L + L GH A + V +SP ++L S DG Sbjct: 498 GYKQAFIASGSEDSQVYIWHRSTGKL--IVELPGHAGA-VNCVSWSPTNLHMLASASDDG 554 Query: 478 LVKLWDI 498 +++W + Sbjct: 555 TIRIWGL 561 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 448 NLLYSTGLDGLVKLWDIRAG 507 N L S+ DG+VKLWD+ G Sbjct: 767 NYLASSDYDGIVKLWDVTTG 786 >At3g13290.1 68416.m01673 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1322 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 + L SI + ++ ++L + R H + +T + F ++ +LL S LDG V +W Sbjct: 195 ICYGLKGGSIRVLNIN-TALRSLFRGHSQR---VTDMAFFAEDVHLLASVSLDGKVFVWK 250 Query: 496 IRAG 507 I G Sbjct: 251 ISEG 254 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 415 LTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 507 +T V FS D + ++ G+D VK+WD+R G Sbjct: 183 ITAVSFSDAADKI-FTGGVDNDVKVWDLRKG 212 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSS-LHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 +A + SD +I+I +S++ Q+ L GH+ PK ++L S DG V LW Sbjct: 26 IATASSDCTIKITGVSNNGGSQQLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILW 85 >At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum] GI:7385017; contains Pfam profiles PF00201: UDP-glucoronosyl and UDP-glucosyl transferase, PF01535: PPR repeat Length = 1184 Score = 29.1 bits (62), Expect = 3.9 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +1 Query: 328 LSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAG 507 L NS IY L ++C+L +EA + D ++Y+T +DG K DIRA Sbjct: 755 LKPNSY-IYGSIIGLLCRICKLAEAEEAFSEMIRQGILPDTVVYTTLIDGFCKRGDIRAA 813 Query: 508 GSCVLE 525 E Sbjct: 814 SKFFYE 819 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/80 (25%), Positives = 43/80 (53%) Frame = +1 Query: 310 LNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKL 489 L+LA+ L ++ ++++ S+ H V L G E+ + + ++ +++L + G+DG + Sbjct: 165 LDLAVGLDNSEVQVWDCV-SNRH-VRTLRGGHESRVGSLAWN---NHILTTGGMDGKIVN 219 Query: 490 WDIRAGGSCVLEYKDEEEEI 549 D+R S + Y EE+ Sbjct: 220 NDVRIRSSIIGTYVGHTEEV 239 >At3g26480.1 68416.m03301 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (5 copies, 2 below cutoff); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 764 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 337 NSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLL---YSTGLDGLVKLWDIRA 504 N++ +Y ++ ++ L H A +T V+ P D + +++ LDG +++W+ A Sbjct: 28 NTVSVYSVATGL--KITSLEDHT-APVTSVIVDPSSDETVSYCWTSSLDGKIRIWEFSA 83 >At1g20540.1 68414.m02559 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Rbap46 polypeptide (GI:9454362) [Gallus gallus] Length = 351 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/90 (16%), Positives = 45/90 (50%) Frame = +1 Query: 232 KKYKIVTEHAVSLLHSYIHRLDGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEA 411 K +++++ + +LHS +N + ++S++ + L + +++ + A Sbjct: 155 KSAEVLSKDSAGMLHSLSGGAWDPHDVNAVAATGESSVQFW-----DLRTMKKVNSIEHA 209 Query: 412 TLTQVVFSPKEDNLLYSTGLDGLVKLWDIR 501 + V ++PK +++L + + + +WD+R Sbjct: 210 HVRGVDYNPKREHILVTAEDESGIHVWDLR 239 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 28.7 bits (61), Expect = 5.1 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA + D++++I ++ L GH+ T V F P+ ++ S LD V+LW+ Sbjct: 118 LASTHGDHTVKIIDCETGKCLKI--LTGHRR-TPWVVRFHPRHSEIVASGSLDHEVRLWN 174 Query: 496 IRAGGSCV 519 + G C+ Sbjct: 175 AKT-GECI 181 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 28.7 bits (61), Expect = 5.1 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 LA + D++++I ++ L GH+ T V F P+ ++ S LD V+LW+ Sbjct: 118 LASTHGDHTVKIIDCETGKCLKI--LTGHRR-TPWVVRFHPRHSEIVASGSLDHEVRLWN 174 Query: 496 IRAGGSCV 519 + G C+ Sbjct: 175 AKT-GECI 181 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.3 bits (60), Expect = 6.8 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 5/110 (4%) Frame = +1 Query: 295 DGTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDN-----LLY 459 D T SL LA D++ +I+ + S+ R H + T+ P +N L Sbjct: 457 DPTGSL-LASCSDDSTAKIWNIKQSTFVHDLREHTKEIYTIRWSPTGPGTNNPNKQLTLA 515 Query: 460 STGLDGLVKLWDIRAGGSCVLEYKDEEEEILRPYECMDVSCNGIVLCTGS 609 S D VKLWD G + + E P + S NG + +GS Sbjct: 516 SASFDSTVKLWDAEL-GKMLCSFNGHRE----PVYSLAFSPNGEYIASGS 560 >At5g43920.1 68418.m05372 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to will die slowly protein (WDS) (SP:Q9V3J8) [Drosophila melanogaster] Length = 523 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +1 Query: 298 GTKSLNLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDG 477 G S +A D+ + I+ L ++ +V L GH T+ V ++PK +L S D Sbjct: 452 GLDSSFIASGSEDSQVYIWNLKNTKPLEV--LSGHS-MTVNCVSWNPKNPRMLASASDDQ 508 Query: 478 LVKLW 492 +++W Sbjct: 509 TIRIW 513 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/62 (22%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSD-SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 + ++ + + I++Y S + L Q + H A +P + + G D L+K+W Sbjct: 422 IGVAFTKHLIQLYAFSGPNDLRQHTEIDAHVGAVNDLAFANPNRQLCVITCGDDKLIKVW 481 Query: 493 DI 498 D+ Sbjct: 482 DV 483 >At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 580 Score = 28.3 bits (60), Expect = 6.8 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +1 Query: 316 LAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 +A S ++ L ++ R H + +T++V +P E +LL S+ LD +++WD Sbjct: 427 IAAGFSSGQCRLFDLRENGFISSWRAH---DGYVTKLV-AP-ESHLLVSSSLDKTLRIWD 481 Query: 496 IR 501 +R Sbjct: 482 LR 483 >At1g53090.2 68414.m06012 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +1 Query: 331 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 S N + ++ D + +Q+ E + + +S + LL S DG VKLW I G Sbjct: 551 SSNFEGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGV 610 Query: 511 S 513 S Sbjct: 611 S 611 >At1g53090.1 68414.m06011 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400) (1 below cutoff); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana] Length = 794 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +1 Query: 331 SDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGG 510 S N + ++ D + +Q+ E + + +S + LL S DG VKLW I G Sbjct: 551 SSNFEGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGV 610 Query: 511 S 513 S Sbjct: 611 S 611 >At4g33270.1 68417.m04734 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota,PID:g2253631 Length = 457 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/79 (20%), Positives = 44/79 (55%) Frame = +1 Query: 313 NLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 ++A+ L+++ ++++ +S Q+ L G ++ + + ++ +++L + G+DGL+ Sbjct: 196 HVAVGLNNSEVQLW--DSASNRQLRTLKGGHQSRVGSLAWN---NHILTTGGMDGLIINN 250 Query: 493 DIRAGGSCVLEYKDEEEEI 549 D+R V Y+ +E+ Sbjct: 251 DVRIRSPIVETYRGHTQEV 269 >At4g33260.1 68417.m04733 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); WD-repeat protein -Daucus carota, PID:g2253631 Length = 447 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/79 (20%), Positives = 44/79 (55%) Frame = +1 Query: 313 NLAISLSDNSIEIYKLSDSSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLW 492 ++A+ L+++ ++++ +S Q+ L G ++ + + ++ +++L + G+DGL+ Sbjct: 186 HVAVGLNNSEVQLW--DSASNRQLRTLKGGHQSRVGSLAWN---NHILTTGGMDGLIINN 240 Query: 493 DIRAGGSCVLEYKDEEEEI 549 D+R V Y+ +E+ Sbjct: 241 DVRIRSPIVETYRGHTQEV 259 >At2g47790.1 68415.m05965 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens]; The first 3 exons are identical to that of GB:AJ224957. This gene appears to be a truncated version of that in GB:AJ224957; contains 4 WD-40 repeats (PF00400) Length = 392 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 367 SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWD 495 +S C H + +TQV F P + N L S +DGL+ L++ Sbjct: 161 NSKQVACLEESHMD-DVTQVHFVPNKPNKLLSASVDGLICLFN 202 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 27.9 bits (59), Expect = 8.9 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = +1 Query: 316 LAISLSDNSIEIYKLS--DS----SLHQVCRLHGHKEATLTQVVFSPKEDN-LLYSTGLD 474 +A DN+I ++ S DS S + + + + E + V +SP E N LL S D Sbjct: 281 IASGAGDNAIRLFVDSKHDSVDGPSYNLLLKKNKAHENDVNSVQWSPGEGNRLLASASDD 340 Query: 475 GLVKLWDI 498 G+VK+W + Sbjct: 341 GMVKIWQL 348 >At2g24680.1 68415.m02947 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 851 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/68 (20%), Positives = 33/68 (48%) Frame = +1 Query: 367 SSLHQVCRLHGHKEATLTQVVFSPKEDNLLYSTGLDGLVKLWDIRAGGSCVLEYKDEEEE 546 ++L ++ L ++ ++ K+ +L +G G+ + + G + LEY DE+E Sbjct: 147 NNLGEITLLGQNRMKWFAYLLSMSKDGSLALGSGWKGICEANGVNTGEAFTLEYIDEQET 206 Query: 547 ILRPYECM 570 + +C+ Sbjct: 207 AHKTSQCV 214 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,169,575 Number of Sequences: 28952 Number of extensions: 331685 Number of successful extensions: 1107 Number of sequences better than 10.0: 111 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -