BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P21 (792 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39243| Best HMM Match : HTH_7 (HMM E-Value=0.035) 29 4.3 SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 >SB_39243| Best HMM Match : HTH_7 (HMM E-Value=0.035) Length = 694 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 673 WRRTKKKTKSLLFSIFHIIA-HMIILERKKIYIFSFHFISFDRV*NHND 530 WR SL S+F+ + H+++ I++++ H++ RV H D Sbjct: 523 WRDVGMSVISLFSSLFYFMELHLLLDSDSDIHMYALHYVFLPRVQRHLD 571 >SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 473 PPKFHFTPFGVIYPGSPTVAICP 405 P +F F+P+G + P SP CP Sbjct: 757 PNRFQFSPYGRVTPDSPGFIECP 779 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,988,789 Number of Sequences: 59808 Number of extensions: 500249 Number of successful extensions: 1128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -