BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P20 (803 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 24 1.4 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 23 3.3 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -2 Query: 388 RMISELYNNKLNLPTFFLKNYIICM 314 ++I E+YN +N+ +++Y+ CM Sbjct: 42 KIIDEVYNGNVNVEDENVQSYVECM 66 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 23.0 bits (47), Expect = 3.3 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 466 LIRTIKKCIFSYSFQY*QKLHK*RLYRTVCANIVFQCIDLISCP 597 LIR K CI + Q + H+ RL R V + V +DL+ P Sbjct: 266 LIRMNKLCIQTIGGQIKPRKHEQRLLRNVGVHTV--VLDLLQVP 307 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,113 Number of Sequences: 438 Number of extensions: 4412 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -