BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P16 (821 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.9 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 21 8.9 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 8.9 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 368 VLISSPAAATPMITDTPHPLWQASSAALMVPTFPIHSKVYS 490 V++ A +TP I W S + P F I + +YS Sbjct: 269 VIVMYIACSTPFILAQLWATWDPQSPFIDGPVFVILTLLYS 309 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = +3 Query: 459 LHFQYIQKCILDHHQSNPPV 518 L +Y+++C+++ + PPV Sbjct: 43 LEMKYLERCLMETLRMFPPV 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,885 Number of Sequences: 336 Number of extensions: 4032 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22517873 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -