BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P15 (786 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A3J1D0 Cluster: WblQ protein; n=1; Flavobacteria bacter... 36 1.2 UniRef50_A2E3S5 Cluster: Putative uncharacterized protein; n=1; ... 33 8.1 >UniRef50_A3J1D0 Cluster: WblQ protein; n=1; Flavobacteria bacterium BAL38|Rep: WblQ protein - Flavobacteria bacterium BAL38 Length = 387 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +1 Query: 160 KDISDNYLSKLSSNKLAVHSFNLVHVKHLFRLIIITYHNETSLQNY 297 + I+ YLS++ ++K+ + S++L H+F L +I N T L+NY Sbjct: 279 RSIAKRYLSEIKNDKITLPSWDLSK-NHVFHLFVIRTSNRTELKNY 323 >UniRef50_A2E3S5 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1026 Score = 33.1 bits (72), Expect = 8.1 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 9 FFFRSKYIQKIYQPCMTKFINVIHKYL*NSKTLQYCRIRL 128 F ++K +Q+++QP + +N+ HK+ + YCRI L Sbjct: 96 FLQKAKNLQQVFQPLFDEIMNIYHKFDACTSQDDYCRISL 135 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,781,425 Number of Sequences: 1657284 Number of extensions: 13272162 Number of successful extensions: 31848 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31831 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66673674990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -