BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P09 (794 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1528 + 27474973-27475289,27476890-27477073,27477081-274772... 28 9.8 >07_03_1528 + 27474973-27475289,27476890-27477073,27477081-27477261, 27477270-27478206,27478384-27479035,27479352-27479798 Length = 905 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -1 Query: 629 CWRPPLIKVRLGSCT--FLNYRLATEFNKS-IILL*VIS-VRFP 510 CW PP + +G CT F L + S I+LL IS +RFP Sbjct: 201 CWLPPYFTITIGICTKSFSRTHLPCGYLLSAIVLLVTISRLRFP 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,950,802 Number of Sequences: 37544 Number of extensions: 224903 Number of successful extensions: 332 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -