BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P08 (804 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.4 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 7.7 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.7 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.2 bits (50), Expect = 1.4 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 540 HHRH--RVTRPVLVPHRIHHLHHQIRVIQKVLGRRSVVLN 427 HH+H P + P HH HHQ + +Q + R+ L+ Sbjct: 335 HHQHGNHTMGPTMGPPHHHH-HHQTQSLQHLHYRQPPTLS 373 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 7.7 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 394 LSKRMAM----LGDGDSTSRTHNSQFNHPYGYQPPVQTADDIAAQPPPRSQAD 248 LSKR ++ LG STS T +S+ + P V +D++ +Q+D Sbjct: 167 LSKRRSVSECSLGTASSTSSTASSRNSDRSAGSPSVSESDEVDVIGYTSNQSD 219 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 183 FLHSLNLLWSSRGTCAPSTHTI 248 FL LNL++ S STHT+ Sbjct: 481 FLERLNLIFMSSSLQWSSTHTL 502 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 183 FLHSLNLLWSSRGTCAPSTHTI 248 FL LNL++ S STHT+ Sbjct: 519 FLERLNLIFMSSSLQWSSTHTL 540 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,948 Number of Sequences: 438 Number of extensions: 2061 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -