BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P06 (865 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 4.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.3 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 4.8 Identities = 14/80 (17%), Positives = 35/80 (43%) Frame = -3 Query: 542 YDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 363 Y+K KE++ E+Y ++++++ + + Y + K D +E+ Sbjct: 252 YEKLHNEKEKLLEERTSRERYSRSREREQKSYKNEREYRKYGETSKERSRDRTERER--- 308 Query: 362 SDKQTILDKCNDTIKWLDSN 303 S + I+ ++ K+ + N Sbjct: 309 SKEPKIISSLSNNYKYSNYN 328 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 6.3 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -2 Query: 582 EKSTXQGEQDHHYLRQRSSLQGRDR 508 E+++ + E+++ R+RS + RDR Sbjct: 279 EQNSYKNEREYRKYRERSKERSRDR 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,480 Number of Sequences: 438 Number of extensions: 4249 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -