BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P04 (856 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_13648| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 >SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/53 (45%), Positives = 32/53 (60%) Frame = -3 Query: 698 ACSEQXSRMTAMDNASKNAXXXXXXXXXXXSTGPVKLSSXRELIEIISGAAAL 540 +CSE +RMTAMD A+KNA + + + REL+EIISGAAA+ Sbjct: 277 SCSEHSARMTAMDAATKNAGEMIDKLTLTYNRTRQAVIT-RELVEIISGAAAV 328 >SB_13648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 624 KLTLTFNRTRQAVI 583 KLTLT+NRTRQAVI Sbjct: 6 KLTLTYNRTRQAVI 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,441,285 Number of Sequences: 59808 Number of extensions: 336677 Number of successful extensions: 652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -