BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P04 (856 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-4|AAK68562.1| 299|Caenorhabditis elegans Hypothetical ... 41 0.001 >AC084158-4|AAK68562.1| 299|Caenorhabditis elegans Hypothetical protein Y69A2AR.18a protein. Length = 299 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = -3 Query: 698 ACSEQXSRMTAMDNASKNAXXXXXXXXXXXSTGPVKLSSXRELIEIISGAAAL 540 A SEQ SRMTAMD ASKNA + + + RELIEIISGAA + Sbjct: 248 ATSEQSSRMTAMDGASKNAGEMIDKLTLAFNRTRQAVIT-RELIEIISGAACV 299 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,211,775 Number of Sequences: 27780 Number of extensions: 246468 Number of successful extensions: 451 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2129473654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -