BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P03 (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 34 0.004 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 29 0.16 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 29 0.16 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 28 0.38 AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. 28 0.38 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.2 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 2.0 AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding pr... 25 2.0 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 25 2.7 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 24 6.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 8.2 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 34.3 bits (75), Expect = 0.004 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 539 PYPVEKAVPFPVNIPVDRPYPVHIEKHVPVHIEK 438 PYP++ V P+ IP+ + P IEK VP +EK Sbjct: 197 PYPLQVNVEQPIKIPIYKVIPKVIEKPVPYTVEK 230 Score = 33.5 bits (73), Expect = 0.008 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 542 IPYPVEKAVPFPVNIPVDRPYPVHIEKHVPVHIEK 438 IP +EK VP+ V ++PYP+ +EK PV + K Sbjct: 216 IPKVIEKPVPYTV----EKPYPIEVEKPFPVEVLK 246 Score = 32.7 bits (71), Expect = 0.013 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 542 IPYPVEKAVPFPVNIPVDRPYPVHIEKHVPVHI 444 +P+PV AVP V + + +PYP+ + P+ I Sbjct: 178 VPHPVPIAVPHYVKVYIPQPYPLQVNVEQPIKI 210 Score = 32.3 bits (70), Expect = 0.018 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 8/36 (22%) Frame = -3 Query: 539 PYPVEKAVPFPV------NIPVDRPYPVHIE--KHV 456 PYP+E PFPV +PV +PYPV + KH+ Sbjct: 231 PYPIEVEKPFPVEVLKKFEVPVPKPYPVPVTVYKHI 266 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -3 Query: 524 KAVPFPV----NIPVDRPYPVHIEKHVPVHI 444 K VP PV +PV P P+ + +V V+I Sbjct: 164 KTVPVPVFQKVGVPVPHPVPIAVPHYVKVYI 194 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 542 IPYPVEKAVPFPVNIPVDRPYPVHIEKHVP 453 +P PV + V PV PV P +++ ++P Sbjct: 166 VPVPVFQKVGVPVPHPVPIAVPHYVKVYIP 195 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 29.1 bits (62), Expect = 0.16 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -1 Query: 700 LPRREARPIPR*KNQCPTPLKYTLTAQCPSMSRSQFRTPSXYQCPPLTPS 551 +P+R R K+ +P K T + PS + S+F TP P PS Sbjct: 1323 MPQRRRRNSSNSKHDLMSPCKPTNGSLSPSATHSRFSTPGARSLPLTPPS 1372 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 29.1 bits (62), Expect = 0.16 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -1 Query: 700 LPRREARPIPR*KNQCPTPLKYTLTAQCPSMSRSQFRTPSXYQCPPLTPS 551 +P+R R K+ +P K T + PS + S+F TP P PS Sbjct: 1320 MPQRRRRNSSNSKHDLMSPCKPTNGSLSPSATHSRFSTPGARSLPLTPPS 1369 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 27.9 bits (59), Expect = 0.38 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -1 Query: 655 CPTPLKYTLTAQCPSMSRSQFRTPSXYQCPPLT 557 CP P K+ C + P YQCP LT Sbjct: 28 CPVPPKHYAELGCKPILEEGQCCPKRYQCPELT 60 >AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. Length = 112 Score = 27.9 bits (59), Expect = 0.38 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 290 HIKDEACVTNRIVVGFQILTYSTSLDRTH 204 HI+ + C IV GF +L YST +TH Sbjct: 15 HIRTDLCT--HIVYGFAVLDYSTLTIKTH 41 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 26.2 bits (55), Expect = 1.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 533 PVEKAVPFPVNIPVDRPYPVHI 468 PV VP+P+ IP+ P PV I Sbjct: 625 PVTILVPYPIIIPLPLPIPVPI 646 Score = 23.8 bits (49), Expect = 6.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -3 Query: 542 IPYPVEKAVPFPVNIPV 492 +PYP+ +P P+ +P+ Sbjct: 630 VPYPIIIPLPLPIPVPI 646 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +3 Query: 603 LDMDGHWAVNVYFNGVGHWFFYRGMGRASRRGKXWFGN 716 L+++ + N Y + W R + R+ K WF N Sbjct: 283 LELEKEFLFNAYVSKQKRWELARNLNLTERQVKIWFQN 320 >AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding protein OBPjj5c protein. Length = 155 Score = 25.4 bits (53), Expect = 2.0 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 724 PCIFPNQXLPRREARPIPR*KNQCPTPLKYTLTAQC 617 P + P Q + ARP+P P PL A+C Sbjct: 2 PRLLPEQVIETCRARPLPSVIPGVPDPLPENCIAEC 37 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 749 RSMWTDXTP-VHIPKPXLTPSRSPSHT 672 +S+ TP HIP L P R P+HT Sbjct: 7 KSLQLSTTPEYHIPTXVLDPLRVPNHT 33 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.8 bits (49), Expect = 6.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 521 AVPFPVNIPVDRPY 480 ++PFP N V+RP+ Sbjct: 206 SIPFPTNATVERPF 219 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.4 bits (48), Expect = 8.2 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -1 Query: 568 PPLTPSRSTSRTQ*KRPCRSQLTSPSTGHTQSTS 467 PPL + + RP +S SPS G QS S Sbjct: 427 PPLHALKDFINKEPPRPGQSPTQSPSPGSQQSLS 460 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,820 Number of Sequences: 2352 Number of extensions: 9979 Number of successful extensions: 35 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -