BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_P01 (794 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 25 0.61 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 7.5 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 25.4 bits (53), Expect = 0.61 Identities = 21/52 (40%), Positives = 25/52 (48%) Frame = -2 Query: 703 PVKTDPTLXCTAYKKNRFYLFSKRSPDDVKGPDNDRDIFNEKPSKEDIISAT 548 P KT P+L T K ++ LFSK VK D+DI P KE S T Sbjct: 671 PNKTLPSLPSTLTKNSKQGLFSKLFAKKVK---KDKDIILNVP-KESTQSLT 718 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 7.5 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 211 TLAPTPWLDNKHTVFGRVTRG 149 T P PW + + + GR+ G Sbjct: 122 TKEPPPWETDSYKLIGRIAAG 142 Score = 21.4 bits (43), Expect = 10.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 755 GGVXPXKWRAPE 720 GG P +W APE Sbjct: 797 GGKIPVRWTAPE 808 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,416 Number of Sequences: 438 Number of extensions: 2435 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -