BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O22 (883 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0741 - 21107566-21107838,21107964-21108102,21108189-211084... 29 6.5 02_02_0582 - 11798252-11798908 28 8.6 >07_03_0741 - 21107566-21107838,21107964-21108102,21108189-21108426, 21108629-21108836,21108945-21109066,21109146-21109271, 21109356-21109774,21109844-21110268 Length = 649 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 276 C*NDRLSCIVNNLNRYPHLSSMAFKITKENNRI 178 C + L C+ + + PH+SS+ F +TKEN ++ Sbjct: 588 CIHIGLLCVQPDPDDRPHMSSIIFMLTKENMKL 620 >02_02_0582 - 11798252-11798908 Length = 218 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 866 GAXXXXGGFXXPXXGGGGX*GGKXSGQRGDXFXG 765 G GG GGGG GG+ +G G F G Sbjct: 135 GVHIGHGGVSISTGGGGGAGGGESAGSSGGGFGG 168 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,581,725 Number of Sequences: 37544 Number of extensions: 246004 Number of successful extensions: 601 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2491484208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -