BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O22 (883 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 4.9 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 4.9 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +1 Query: 106 KKRTLTTACTCFVSKN*KRPYTKLNPIVF--FRDFKSH*RQMWIPIQIVYNTA*PVVLTD 279 K + LTT C+V++ + K N F R + ++W P I+YN A P + Sbjct: 48 KNQILTT--NCWVTQIWTDHHLKWNASEFAGIRVIRVPYNRVWRPDTILYNNADPQYSSA 105 Query: 280 LILRNI 297 +I N+ Sbjct: 106 VINTNV 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,796 Number of Sequences: 438 Number of extensions: 3166 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28644972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -