Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_T7_O22
         (883 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    23   4.9  

>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 4.9
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
 Frame = +1

Query: 106 KKRTLTTACTCFVSKN*KRPYTKLNPIVF--FRDFKSH*RQMWIPIQIVYNTA*PVVLTD 279
           K + LTT   C+V++     + K N   F   R  +    ++W P  I+YN A P   + 
Sbjct: 48  KNQILTT--NCWVTQIWTDHHLKWNASEFAGIRVIRVPYNRVWRPDTILYNNADPQYSSA 105

Query: 280 LILRNI 297
           +I  N+
Sbjct: 106 VINTNV 111


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,796
Number of Sequences: 438
Number of extensions: 3166
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)