BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O19 (793 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 156 2e-38 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 5e-33 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 118 5e-27 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 94 1e-19 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 38 0.009 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 37 0.022 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 37 0.022 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_45735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 33 0.35 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 32 0.46 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) 31 1.1 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 31 1.1 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 1.1 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 31 1.4 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) 31 1.4 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 1.9 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_36001| Best HMM Match : CheD (HMM E-Value=3.9) 30 2.5 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 30 2.5 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 30 2.5 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 3.0 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 29 3.3 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 29 3.3 SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) 29 3.3 SB_159| Best HMM Match : TP2 (HMM E-Value=0.58) 29 3.3 SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.3 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 29 3.3 SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) 29 3.3 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 3.3 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 29 3.3 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 29 3.3 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 29 4.3 SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_1024| Best HMM Match : Ank (HMM E-Value=0) 29 4.3 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 29 4.3 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 5.7 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 5.7 SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) 29 5.7 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 5.7 SB_51703| Best HMM Match : LRR_1 (HMM E-Value=1.9e-06) 29 5.7 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 29 5.7 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 29 5.7 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 29 5.7 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) 28 7.5 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 7.5 SB_3823| Best HMM Match : KE2 (HMM E-Value=4.4e-20) 28 7.5 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 28 7.5 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 7.5 SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 28 10.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 28 10.0 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 28 10.0 SB_28595| Best HMM Match : Astacin (HMM E-Value=0.05) 28 10.0 SB_16304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 10.0 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 156 bits (379), Expect = 2e-38 Identities = 67/102 (65%), Positives = 89/102 (87%) Frame = -2 Query: 540 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 361 SKE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K+K+KIS+ DK+ I Sbjct: 513 SKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAI 572 Query: 360 LDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 235 LDKC + +KWLD+NQ A+K+E+E+ QKELE + NPIITK+YQ Sbjct: 573 LDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 686 GSXXXPRGVPQIEVTXDIDANGILNVSAIEKST 588 G PRGVPQIEVT DIDANGILNVSA++KST Sbjct: 465 GIPPAPRGVPQIEVTFDIDANGILNVSAVDKST 497 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 580 ENKITITNDKGRL 542 ENKITITNDKGRL Sbjct: 500 ENKITITNDKGRL 512 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 138 bits (334), Expect = 5e-33 Identities = 60/102 (58%), Positives = 83/102 (81%) Frame = -2 Query: 540 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 361 SKE+IERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDEK+K+K+S+ +++ + Sbjct: 605 SKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKV 664 Query: 360 LDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 235 + +C T+ WL+ NQ A+KEE + QKELEG+ NPIITK+YQ Sbjct: 665 ISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 706 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 686 GSXXXPRGVPQIEVTXDIDANGILNVSAIEKST 588 G PRGVPQI+VT D+D+NGILNVSA++KST Sbjct: 557 GIPPAPRGVPQIDVTFDVDSNGILNVSAVDKST 589 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 580 ENKITITNDKGRL 542 ENKITITNDKGRL Sbjct: 592 ENKITITNDKGRL 604 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 118 bits (284), Expect = 5e-27 Identities = 49/101 (48%), Positives = 77/101 (76%) Frame = -2 Query: 540 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 361 SKEEI+RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + L+ K+S SDK T+ Sbjct: 512 SKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTV 571 Query: 360 LDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMY 238 +K + + WL+ N LA+KEE+E ++KEL+ + +PI+ K++ Sbjct: 572 KNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612 Score = 53.6 bits (123), Expect = 2e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -3 Query: 686 GSXXXPRGVPQIEVTXDIDANGILNVSAIEKST 588 G PRGVPQIEVT DIDANGILNVSA +KST Sbjct: 464 GIPPAPRGVPQIEVTFDIDANGILNVSAKDKST 496 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 94.3 bits (224), Expect = 1e-19 Identities = 42/94 (44%), Positives = 68/94 (72%), Gaps = 1/94 (1%) Frame = -2 Query: 534 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTIL 358 E+IERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D EKL K+S+ DK+TI Sbjct: 1208 EDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTIT 1267 Query: 357 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNP 256 + I W+D NQ A E+++ ++++ + +Y+P Sbjct: 1268 EAVEKAISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = -3 Query: 686 GSXXXPRGVPQIEVTXDIDANGILNVSAIEKSTXXGEQ 573 G PRGVPQIEVT +ID NGIL VSA +K T E+ Sbjct: 1158 GIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEK 1195 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 51.6 bits (118), Expect = 7e-07 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 686 GSXXXPRGVPQIEVTXDIDANGILNVSAIEKSTXXGEQ 573 G PRGVPQ+EVT DIDANGI+NVSA +K T +Q Sbjct: 269 GIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQ 306 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = -2 Query: 510 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS-DSDKQTILDKCNDTIK 334 EA K R DD + +AKNALES+ F ++ M E L EK+S +++++TI + Sbjct: 704 EAPKAR--DDAKAANERAKNALESHIFGVRDEMNSE-LGEKLSTEAERETISEALTAASD 760 Query: 333 WLDSN 319 WLD + Sbjct: 761 WLDED 765 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 3/98 (3%) Frame = -2 Query: 525 ERMVNEAEKYRNEDD-KQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDK 352 ER A +Y D + + +A+ L++ S K T+ D +K + + D+ + Sbjct: 712 ERAREAATRYNKVDCIEYLDKAEAQFELKALITSTKETIADPDKHMGRFTKDDRVSGNRY 771 Query: 351 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 241 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 772 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 809 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 36.7 bits (81), Expect = 0.022 Identities = 24/107 (22%), Positives = 49/107 (45%) Frame = -2 Query: 597 EVHQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 418 E + T T K +K+E E E ++ + + +K++E + + + ++ Sbjct: 6 ETEKEGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKEA 65 Query: 417 TMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 E E KEK ++K+ K +T K ++ + A+ E+ E +KE Sbjct: 66 ETEKEAEKEKKKKTEKEEEKGKQEETGKEAETEKQAETEKQEETEKE 112 Score = 29.1 bits (62), Expect = 4.3 Identities = 22/80 (27%), Positives = 38/80 (47%) Frame = -2 Query: 510 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKW 331 E EK E +K+ ET + + + E +K EK + KQ +K +T K Sbjct: 6 ETEK-EGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKE 64 Query: 330 LDSNQLADKEEYEHKQKELE 271 ++ + A+KE+ + +KE E Sbjct: 65 AETEKEAEKEKKKKTEKEEE 84 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/91 (25%), Positives = 45/91 (49%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 164 Query: 357 DKCNDTIKWLDSNQLADKEEYEHKQKELEGI 265 +K + + + L D+ + E +Q EG+ Sbjct: 165 EKVKN--EGEEERMLHDQRQKEEEQWRKEGV 193 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/94 (26%), Positives = 53/94 (56%), Gaps = 1/94 (1%) Frame = -2 Query: 549 VVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM-KSTMEDEKLKEKISDSD 373 V SKE+++ ++EA +D + ++A + ++ S+ + E E +KE + +++ Sbjct: 1032 VYQSKEKLQHRLDEA--LCKQDQYKNSLVEAVDEAKTLKESLYRMVNEHETMKESLLNAN 1089 Query: 372 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 ++ KC +T K LD+++ D+E+ E Q+E E Sbjct: 1090 REIGRLKCENTAKNLDADRKEDQED-EEVQREGE 1122 Score = 35.1 bits (77), Expect = 0.066 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Frame = -2 Query: 555 TKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISD 379 T++V EE + E + + +++ E I +KN+ L + S +E+ +E +SD Sbjct: 1934 TEMVKKNEEKNNEIEEMREKMRKANEEIEKILSKNSKLSDILNELNSGIENILNEETLSD 1993 Query: 378 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 SD L K + + L+ KEE E +E Sbjct: 1994 SDPNVKLQKLREKFENLEKQVNNVKEEAEKNVQE 2027 Score = 30.7 bits (66), Expect = 1.4 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 4/92 (4%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNE--DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 364 KE+++ +VN + +E D+K K + K L+ + + K + +DS K+ Sbjct: 1635 KEKVD-LVNSLHEKMSEMNDEKDKLDDENKQLLDEKSREVTDLKGEVKKAQDDADSVKRL 1693 Query: 363 I--LDKCNDTIKWLDSNQLADKEEYEHKQKEL 274 + + + NDT+K + + LA +E+ EH EL Sbjct: 1694 VDAIIEENDTLKQSEHDLLAIQEDLEHTIDEL 1725 Score = 30.3 bits (65), Expect = 1.9 Identities = 25/87 (28%), Positives = 44/87 (50%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 KEE E +V + + RN+ K+ E ++++ L K M+DE K + ++ +L Sbjct: 2543 KEEAEGLVEKLKVQRNQMIKEIEELKSEKGL----LEQKQQMQDEAQKLR----NEIEVL 2594 Query: 357 DKCNDTIKWLDSNQLADKEEYEHKQKE 277 K + I D+NQ ++KE K K+ Sbjct: 2595 KKLH-AIALEDANQKSEKELRREKMKK 2620 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 33.9 bits (74), Expect = 0.15 Identities = 29/104 (27%), Positives = 57/104 (54%), Gaps = 7/104 (6%) Frame = -2 Query: 555 TKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 376 +++ +S E+I +E + +N DK + + ++ E S K ++ +K ++ D Sbjct: 137 SELQNSSEKISEDEHEISQLKN--DKARCMQELRDEREK---SNKLVVDLQKTRKAQDDC 191 Query: 375 DKQTILDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 265 +K+ +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 192 EKE--VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_45735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 33.5 bits (73), Expect = 0.20 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 2/108 (1%) Frame = -2 Query: 555 TKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 376 TK + ++ ++V EA + +++ +K + ALE Y + + + E + Sbjct: 273 TKQTETLRKLTKLVQEARQNHDDESVKKAVNEYDEALERYIPVLMAQAKIYWDLENYAQV 332 Query: 375 DK--QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMY 238 +K + ++ CN+ W N E+K KE G Y PI+ K Y Sbjct: 333 EKIFRKSVEFCNEHEVW-KLNVAHVLFMQENKYKEAVGFYEPIVKKHY 379 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 33.1 bits (72), Expect = 0.27 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 1/86 (1%) Frame = -2 Query: 528 IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD-K 352 ++ +VNE +K + + D QK+ I+ + ES + ME EKLKE DK + L+ Sbjct: 1187 LKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKLKE---SKDKISKLEGT 1239 Query: 351 CNDTIKWLDSNQLADKEEYEHKQKEL 274 ND K L+ L+ KE E K +E+ Sbjct: 1240 LNDKAKALEKAHLSLKEA-ETKLEEM 1264 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 32.7 bits (71), Expect = 0.35 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 6/131 (4%) Frame = -2 Query: 615 QRFRYREVHQXXRTRSPLPTTKVVSSKEEIERMVNE--AEKYRNEDDKQKETIQAKNALE 442 ++ Y E +++ T ++S + +R +E E ++N + + +N L Sbjct: 34 KKLSYEETETSNSSQAQKTHTNTLASSKTGKRQHSERDVEIFKN----RSKIAYLENELN 89 Query: 441 SYCFSMK-STMEDEKLKEKISDS--DKQTILDKCNDTIKW-LDSNQLADKEEYEHKQKEL 274 S S K + +E+++ EK DK+ L + T+K+ LD +LA KE++ +KE Sbjct: 90 SAEKSQKRARVENDRDSEKHKRDLRDKEQELSELRKTVKYALDQEKLA-KEQFGDLKKEF 148 Query: 273 EGIYNPIITKM 241 EG + TKM Sbjct: 149 EGYKKKMDTKM 159 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 32.7 bits (71), Expect = 0.35 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 8/111 (7%) Frame = -2 Query: 579 RTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQ--KETIQAK---NALESYCFSMKST 415 + PLP TK +EE +E E E+ ++ K+ ++AK + +S C S + + Sbjct: 631 KIEEPLPRTKKPEKEEEESEEESEEESEEEEETEKVNKDALKAKATEKSNDSLCLSEEES 690 Query: 414 MEDEKLKEKISDSD---KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 E+E +E D + K + K T + + DK++ E E E Sbjct: 691 EEEESEEESEEDEEEGAKPSASAKIAKTSETENKVPKVDKDDEEDDDDEEE 741 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/88 (25%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 K++ ER E ++ + + +K+K+ + K +E + + E+L+EK + +KQ Sbjct: 914 KDKREREEKERKRRQQQLEKEKKEKEKKLLIEKE--KREKEKQKERLREK-EEKEKQKEA 970 Query: 357 DKC-NDTIKWLDSNQLADKEEYEHKQKE 277 ++ + + L ++L +KEE + K KE Sbjct: 971 ERAKKEKERLLQEDKLHEKEEKDRKDKE 998 Score = 29.1 bits (62), Expect = 4.3 Identities = 39/128 (30%), Positives = 56/128 (43%), Gaps = 16/128 (12%) Frame = -2 Query: 606 RYREVHQXXRTRSPLPTTKVVSSKE---EIERMVNEAEKYR----NEDDKQKETIQAKNA 448 R RE + R + L K K+ E E+ E +K R E +KQKE +AK Sbjct: 917 REREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAKKE 976 Query: 447 LESYCFSMK---STMEDEKLKEKIS------DSDKQTILDKCNDTIKWLDSNQLADKEEY 295 E K +D K KEK + DKQ +K D++K + + +DKE Sbjct: 977 KERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKDKQVEKEK-KDSLKRVKKRKDSDKER- 1034 Query: 294 EHKQKELE 271 + K+KE E Sbjct: 1035 KVKEKEEE 1042 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/90 (23%), Positives = 45/90 (50%) Frame = -2 Query: 534 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD 355 EE+ER+ E +K E+ K++ET++ K L+ +E+E+ + + + ++Q Sbjct: 285 EELERLKEEKDKMLEEELKKRETLEEKQKLQD------KILEEERKRLENLEKERQAAQQ 338 Query: 354 KCNDTIKWLDSNQLADKEEYEHKQKELEGI 265 + L + + A K+ E +K++ I Sbjct: 339 AMQEAHDKLAAAEEAAKKASEEAKKKVREI 368 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -2 Query: 504 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 334 E+ D QKE QA +E Y S++ E KE + S+K+ + ++C + IK Sbjct: 13 EESTRAGDLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQENIK 65 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/89 (20%), Positives = 46/89 (51%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ + KQ + Sbjct: 88 KQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQ-EEQKQEVQEEQ-KQEVQEEQKQEVQ 145 Query: 357 DKCNDTIKWLDSNQLADKEEYEHKQKELE 271 ++ ++ + +E+ E KQ+E E Sbjct: 146 EEQKQEVQ----EEQKQEEQEEQKQEEQE 170 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/87 (18%), Positives = 40/87 (45%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 K+E ++ + E+ + E ++QK+ +Q + E + E++K + + ++ Sbjct: 104 KQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEEQEE 163 Query: 357 DKCNDTIKWLDSNQLADKEEYEHKQKE 277 K + + Q K+E + +QK+ Sbjct: 164 QKQEEQEEQKQEVQEEQKQEVQEEQKQ 190 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = -2 Query: 513 NEAEKYRN-EDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTI 337 N EK +N E K K + + A E S++ ++ E+ EK ++T D+ N TI Sbjct: 1658 NNHEKEQNIESIKDKLWAEFEEAKED---SVREALDSER--EKWRKEYEKTTQDEINKTI 1712 Query: 336 KWLDSNQLADKEEYEHKQ 283 +L+ EE++HK+ Sbjct: 1713 SYLEDQYTRGLEEFKHKE 1730 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 31.5 bits (68), Expect = 0.81 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 1/93 (1%) Frame = -2 Query: 552 KVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALE-SYCFSMKSTMEDEKLKEKISDS 376 K S E++E+ NEAEK N K+KE + ++ + KS++ +E + S Sbjct: 175 KKTSEIEDLEKERNEAEKKYNSLRKEKENLVSELTKKFEMLEGQKSSLVEENKVLQDSVK 234 Query: 375 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 D + L K N + + + EE E +K+ Sbjct: 235 DLKIRLKKSNQDLNKITEELKSTLEEIEMVKKK 267 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 351 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 241 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) Length = 837 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -2 Query: 555 TKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 418 TK V +EE E AE DD Q++ +A ALE+ S+KS Sbjct: 154 TKTVVQREEAEAAKKAAETQAIADDAQRDLDEALPALEAALASLKS 199 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 31.1 bits (67), Expect = 1.1 Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 3/95 (3%) Frame = -2 Query: 540 SKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 361 +K+E+ER+ +K D+K+KE ++ K L+ TME ++L+ +SD+ + Sbjct: 3504 TKDELERL----KKIVENDEKEKENLKRK--LQG--SDSDGTMERKRLQRDMSDARAE-- 3553 Query: 360 LDKCNDTIKWL-DSNQLADKEEYE--HKQKELEGI 265 + + +K L D +LA K+ E K +E+E + Sbjct: 3554 ISRLEKEVKRLKDDQELARKQRQEVIEKGREIEDL 3588 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 282 Query: 357 DK 352 +K Sbjct: 283 EK 284 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = -2 Query: 552 KVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISDS 376 ++ + + E+E+ E EK DK+K+ ++ N L S+ S + DE KE +D+ Sbjct: 832 ELATCRSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL-DEMKKESENDA 890 Query: 375 DKQTILD 355 Q ILD Sbjct: 891 QCQKILD 897 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 30.7 bits (66), Expect = 1.4 Identities = 26/116 (22%), Positives = 47/116 (40%), Gaps = 4/116 (3%) Frame = -2 Query: 606 RYREVHQXXRTRSP---LPTTKVVSSKEEIERMVNEAEKYRNED-DKQKETIQAKNALES 439 + R+ R+RSP + V S E+ R EK + DK K+ + + + Sbjct: 278 KQRDKSDDRRSRSPERKIKEDSVTKSDEDEGRSSERREKEEKKSRDKDKDRERERKDKKD 337 Query: 438 YCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 + +K ++K D DK+ +K + K D + DK+ K ++ E Sbjct: 338 RDRGRNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKE 393 >SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) Length = 782 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 8/77 (10%) Frame = -2 Query: 474 KETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD------KCNDTIKWL--DSN 319 KE +Q + L ++ + K +E EK+ IS +D + +L+ K + I+ L + + Sbjct: 299 KERLQIERKLANFTKTSKKEVESEKV---ISRTDGKKVLELEKDISKKKNEIRRLRTELS 355 Query: 318 QLADKEEYEHKQKELEG 268 QL + +++H +KELEG Sbjct: 356 QLQENSKHKHFEKELEG 372 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 1.4 Identities = 27/115 (23%), Positives = 54/115 (46%), Gaps = 1/115 (0%) Frame = -2 Query: 618 PQRFRYREVHQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 439 P R YRE + R K K++ ++ N+ K +K+K+ ++ K E+ Sbjct: 8 PMRREYRE----EKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEA 63 Query: 438 YCFSMKSTMEDEKLKEKISDSDKQ-TILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 + T+E E +EKI +++K+ +K + K + ++EE E +++E Sbjct: 64 EVG--EKTLEAENEEEKIEETEKEKDEEEKIEEEEKEGGEEENEEEEEEETEEEE 116 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 367 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = -2 Query: 546 VSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 382 V K+E R+ +EAEK E++K K+ + + + Y ++ + K K+K S Sbjct: 464 VKKKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTKQKQKES 518 >SB_36001| Best HMM Match : CheD (HMM E-Value=3.9) Length = 313 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/95 (21%), Positives = 47/95 (49%) Frame = -2 Query: 561 PTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 382 P+ +V+ + + ++ M N+ E +E+D++ + I+ +NA+E + + LKE S Sbjct: 216 PSVEVLENLDILDEMSNDVE---DEEDEEDDAIEKENAIED-----EDNLYAIILKEYFS 267 Query: 381 DSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 ++D ++ + L N + D++ + E Sbjct: 268 ETDTESEDENRQPRTDSLSVNDINDRQVETRSENE 302 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 29.9 bits (64), Expect = 2.5 Identities = 25/107 (23%), Positives = 49/107 (45%) Frame = -2 Query: 579 RTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 400 R S K +EE +++ + +K+ ++ K+ E ++ KNA E++ Sbjct: 42 RKASNKSAEKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKS 96 Query: 399 LKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYN 259 LK K S+S + + + +LA ++E KQK+ E I++ Sbjct: 97 LKGKTSNSSAKMTRAQITE-----HQAKLAAEQEKLQKQKQQETIHD 138 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/80 (27%), Positives = 38/80 (47%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 K+E ER+ +AEK + K+KE ++ K E K E+EK K++ + K Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEK 404 Query: 357 DKCNDTIKWLDSNQLADKEE 298 K + K + ++ KE+ Sbjct: 405 KKREEKKKQEEEEKMKKKEQ 424 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 24.2 bits (50), Expect(2) = 3.0 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -3 Query: 260 IR*LRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPS 135 IR + R PE+ EV S + P L+ L PPS Sbjct: 20 IRNIMSRRRFPEDDLEVSSVSASASSSTSRPTNALQPLKPPS 61 Score = 23.8 bits (49), Expect(2) = 3.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 149 LAPPSRRSIKPTFHTTLKPTCNNH 78 L PPSR+S P HT P+C ++ Sbjct: 80 LTPPSRQSNNPRPHT--PPSCQSN 101 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 29.5 bits (63), Expect = 3.3 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -2 Query: 543 SSKEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSD 373 S K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ Sbjct: 135 SQKIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESN 193 Query: 372 KQTILDKCND 343 + KC D Sbjct: 194 LEDAEKKCKD 203 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 29.5 bits (63), Expect = 3.3 Identities = 27/121 (22%), Positives = 55/121 (45%), Gaps = 2/121 (1%) Frame = -2 Query: 627 QRYPQRFRYREVHQXXRTRSPLPTTKVVSSKEEI--ERMVNEAEKYRNEDDKQKETIQAK 454 ++ +R + E T T K +++E E+ ++ + E + Q E +A+ Sbjct: 121 EKEAEREKEAEREIEAETEKEAETEKEAQTEKEAQTEKEAGTEKEAQTEKEAQMEK-EAE 179 Query: 453 NALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 274 E+ T E E +EK ++++K+ +K +T K + + A+ ++ KQKE Sbjct: 180 TEKEAQTEKEAQT-EKEAEREKEAETEKEAKTEKEAETEKEAQTEKEAETQKEAEKQKEA 238 Query: 273 E 271 E Sbjct: 239 E 239 >SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 623 GILNVSAIEKSTXXGEQDHHYQRQRSSLPRKRSSVWLMRQ 504 G LN + + ++DHH +R+R + +++SVW RQ Sbjct: 382 GDLNSNFHTNDSLFPQKDHHSKRKRHNAVTEKASVWHTRQ 421 >SB_159| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 623 GILNVSAIEKSTXXGEQDHHYQRQRSSLPRKRSSVWLMRQ 504 G LN + + ++DHH +R+R + +++SVW RQ Sbjct: 382 GDLNSNFHTNDSLFPQKDHHSKRKRHNAVTEKASVWHTRQ 421 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 29.5 bits (63), Expect = 3.3 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%) Frame = -2 Query: 555 TKVVSSKEEIERMVNEAEKYRNEDDK---QKETIQAKNALESYCFSMKSTMEDEKLKEKI 385 T++ + K E+ER VNE + + +K ++ ++ K E F +K T +++LK+K+ Sbjct: 233 TELENDKRELERQVNELKAKCDAIEKREAERRAVEEKKHAEEIQF-LKRT--NQQLKQKM 289 Query: 384 SDSD-KQTILDKC 349 S+ D + + KC Sbjct: 290 SEPDSSKWVACKC 302 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 370 KEE ER+ EAE+ R ED++Q+ + + A E +K M+ K + + ++ D+ Sbjct: 417 KEEEERLRVEAERQREEDERQRAEDERQRA-EDERQRVKHEMQRLKDERRRAEEDE 471 Score = 29.1 bits (62), Expect = 4.3 Identities = 28/125 (22%), Positives = 60/125 (48%), Gaps = 6/125 (4%) Frame = -2 Query: 627 QRYPQRFRYREVH--QXXRTRSPLPTTKVVSSKEE--IERMVNEAEKYRNEDDKQKETIQ 460 QR + RY+E+ + + R + + +EE I R EAE+ R E +++++ + Sbjct: 485 QREKELKRYKELQMAEEEKRRKETEERERQAREEEDRIRREREEAERLRREKEQREQLVP 544 Query: 459 AKNALESYCFSMKSTMEDEKLK-EKISDSDKQTILDKCNDTIK-WLDSNQLADKEEYEHK 286 +ALE C + + ++K +K+ + ++ + +K + +L +K + E Sbjct: 545 HSDALE--CAIKPLNLLEARIKAQKLEEEQRELERLQAEAELKRKQELERLREKRKEEKA 602 Query: 285 QKELE 271 Q+E E Sbjct: 603 QRERE 607 >SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) Length = 82 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -2 Query: 423 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 274 K T ED++ ++K ++SD Q + N T K +L + +E K+ EL Sbjct: 33 KVTQEDQEPEKKSNESDPQKDQETDNKTSKKESQEELREADETPKKKDEL 82 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 185 PEPEVPPPGLEALAPPSRRSIKP-TFHTTLKPTCNNHLVTSP 63 P+P+ PPPG PPS + P T +P VT P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP 69 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -2 Query: 567 PLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKE---TIQAKNALESYCFSMKSTMEDEKL 397 P+P KV ++ + V++ + N+DDK+KE + E++ SM+ + D++ Sbjct: 970 PIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEETEAHIISMQEEVNDDET 1029 Query: 396 KEK 388 +E+ Sbjct: 1030 EEE 1032 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = -2 Query: 579 RTRSPLPTTKVVSSKEEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 403 R R+ ++ E+ E+++ + AEK R +K+KE + E F + + +DE Sbjct: 1431 RRRAQKEKEDLIYDHEKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSKKDE 1490 Query: 402 KLKEKISD 379 L +K+ D Sbjct: 1491 DLAQKLQD 1498 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 29.5 bits (63), Expect = 3.3 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -2 Query: 543 SSKEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSD 373 S K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ Sbjct: 872 SQKIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESN 930 Query: 372 KQTILDKCND 343 + KC D Sbjct: 931 LEDAEKKCKD 940 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.1 bits (62), Expect = 4.3 Identities = 27/120 (22%), Positives = 57/120 (47%), Gaps = 1/120 (0%) Frame = -2 Query: 627 QRYPQRFRYREVHQXXRTRSPLPTTKVVSSKEEIERMVNE-AEKYRNEDDKQKETIQAKN 451 +R Q+ R RE + R L + V S ++ ++ A+K E++++++ + Sbjct: 228 ERLEQQRRQRE-QRIAEKRKRLEEQRKVESLHLLKELLKRVADKRAEEEEEKRKREKELE 286 Query: 450 ALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 L + E+E++KE++ +KQ + K K L L + +E + +++ELE Sbjct: 287 MLRQIEEKKRKLEEEERIKEEV---EKQKKI-KLEQQEKELRDKLLKNLKEMKERKQELE 342 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Frame = -3 Query: 557 RQRSSLPRKRSSVWLMRQR--STETRMTSKRR--PSRPRMHWNLTASA 426 R+RS P+KR + + R+R S + R+TSK++ P R + TA+A Sbjct: 275 RRRSDTPKKRRRISVPRRRAGSAQGRLTSKKKTPPRRTNLLEAFTAAA 322 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 29.1 bits (62), Expect = 4.3 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 2/84 (2%) Frame = -2 Query: 606 RYREVHQXXRTRSPLPTTKVVSSKEEIER-MVNEAEKYRNEDDKQKETIQAKNALESYC- 433 +YRE + RTR + TT++ + +E R +V E E+ +E + ++ I A E+ Sbjct: 124 KYREQTEDLRTRLRM-TTELCAKQEAYYRDIVKELEERLHETIEGRDHILALRESEAASQ 182 Query: 432 FSMKSTMEDEKLKEKISDSDKQTI 361 ++ +E LK+K S +DK + Sbjct: 183 LNLVKQLEAALLKQKQSAADKDQL 206 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/83 (20%), Positives = 40/83 (48%) Frame = -2 Query: 633 RCQRYPQRFRYREVHQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAK 454 R ++ Q+ + +E + R + + + ++E ++ E EK ++++ K+KE + K Sbjct: 309 RQEKLEQKAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREK 368 Query: 453 NALESYCFSMKSTMEDEKLKEKI 385 LE E ++ KE++ Sbjct: 369 EKLEKEKQKELERKELQRQKERM 391 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -2 Query: 543 SSKEEIERMVNEAEKYRNED--DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 370 + K+E ER E EK R ++ ++KE + + E K E ++ KEK+ + +K Sbjct: 317 AKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKL-EKEK 375 Query: 369 QTILDK 352 Q L++ Sbjct: 376 QKELER 381 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 4/94 (4%) Frame = -2 Query: 540 SKEEIERMVNEAEKYRNEDDKQ----KETIQAKNALESYCFSMKSTMEDEKLKEKISDSD 373 +KE+ E+M E ++ ++ DK+ KE + ++ E M ++E KE + D Sbjct: 22 NKEDKEKMDKEDKEEMDKQDKENKEDKEEMDKEDKEEMDQEEMDKEDKEEMDKEDKEEMD 81 Query: 372 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 ++ +DK + +D DKEE + ++ + E Sbjct: 82 QEE-MDKEEMDQEEMDKEDKEDKEEMDQEEMDKE 114 >SB_1024| Best HMM Match : Ank (HMM E-Value=0) Length = 891 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 230 PEESP--EVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 114 PE+ P EV A R E P+ E PP +PP ++ KPT Sbjct: 771 PEQPPIGEVESAVRREQPKSEKTPPSTTP-SPPPKQPSKPT 810 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 Query: 221 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTS 66 S + C A+ P + L+ P S S +PT TL CNN TS Sbjct: 417 SEQYCYFGDAKVPATFMNDTTLKCTVPTSSVSSRPTVAVTLNGGCNNFTTTS 468 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = -2 Query: 624 RYPQRF--RYREVHQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKN 451 R P++F ++ V + + V + EE+E N+ ++ +DDK++ET K Sbjct: 11 RSPKKFSWNHKMVKKKEKKNKLAALAAAVEAAEEVE---NKMDEMSVKDDKREETQSDKK 67 Query: 450 ALESYCFSMKSTMEDEK 400 + + S EDEK Sbjct: 68 SAKESTKSSSKPAEDEK 84 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 28.7 bits (61), Expect = 5.7 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -2 Query: 495 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQ 316 +N E + + + SY K + EK KEK + +K+ ILD K++ N Sbjct: 1081 KNSQTPLLEILSPRKDIGSYKSCPKLRKKREKEKEKDKEKEKEVILD-FEALDKFIGRNP 1139 Query: 315 LADKEEY-EHKQKELEGI 265 + E+ E + ELE I Sbjct: 1140 MTQIAEFREAEAAELEAI 1157 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/55 (23%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -2 Query: 411 EDEKLKEKISDSDK-QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 250 ++E L++++S+ ++ Q ++++ N+T+K L +K+E K L+ +N ++ Sbjct: 31 DNESLQKRVSELEEHQKVIEETNETLKKQHETVLFEKDELTLTIKTLQEEFNTML 85 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.7 bits (61), Expect = 5.7 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = -2 Query: 552 KVVSSKEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDS 376 K+ + +++ + A + + DK + IQ +NA +S +KSTM +K K+ D Sbjct: 512 KIRRLEVQVDNLAQLASSLKKDKDKVSKQIQDLRNATQSAIKKIKSTM----MKRKMIDE 567 Query: 375 DKQTILDKCNDTIKWLDSNQLADK--EEYEHKQK 280 ++ + N + L+ Q K EE E +K Sbjct: 568 VYCDLVKRVNHHLADLNERQKQQKIAEEQERLRK 601 >SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) Length = 207 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/99 (19%), Positives = 43/99 (43%) Frame = -2 Query: 546 VSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ 367 ++ +I +MVN + +D + E + ++ K M+ L +++ +K Sbjct: 18 LNDMSKIVQMVNNTARVTRKDARDTEA----SCVDVSLSVRKKNMDILHLNDEVKRYEKL 73 Query: 366 TILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 250 +D+ L+ + E EHK +ELE ++ ++ Sbjct: 74 LAMDRKLPRRSILEERLGRAEAELEHKDRELENLHKQVV 112 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 6/88 (6%) Frame = -2 Query: 543 SSKEEIERM--VNEAEKYRN-EDDKQKETIQAK--NALESYCFSMKSTMEDEKLKEKISD 379 + KEEIE NE E+ EDD +KE I+ + + + + E+E+++E+ D Sbjct: 155 NEKEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDEREDDNEEEEIEEREDD 214 Query: 378 SDKQTILDKC-NDTIKWLDSNQLADKEE 298 D+ D+ ND + + ++ D + Sbjct: 215 DDEVEERDETENDNDEGEEREEMEDDND 242 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 28.7 bits (61), Expect = 5.7 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 13/97 (13%) Frame = -2 Query: 531 EIER--MVNEAEKYRNED------DKQKETIQAKNALESYCFSMKSTMEDEKL-----KE 391 EIE+ +++AE + NED D E A E ++ E E++ E Sbjct: 1413 EIEKASQIDQAEDFPNEDEVPAVIDLLPENSSAFGISEEKIDGIQEAKESEEIVSSGETE 1472 Query: 390 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 280 +I D D ++D ++ L ++ D+EE E ++K Sbjct: 1473 EIEDEDTPVVVDILSEDTSALGISEERDEEEIEQQKK 1509 >SB_51703| Best HMM Match : LRR_1 (HMM E-Value=1.9e-06) Length = 632 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -2 Query: 624 RYPQRFRYREVHQXXRTRSPLPTTKVVS--SKEEIERMVNEAEKYRNEDDKQ-KETIQ 460 RY F++ E+ R+ SP+P+ +S S EE E E Y +++D + KE IQ Sbjct: 346 RYHVEFKFLELPYVVRSASPVPSIPTISITSPEEEE---GATEPYVDQEDLEVKENIQ 400 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = -2 Query: 597 EVHQXXRTRSPLPTTKVVSSKEEIERMVNEAEK--YRNEDDKQKETIQAKNALESYCFSM 424 ++H+ R ++P K + K+ E+ V + E+ + + +K + + K Sbjct: 276 KIHKKDREKTPTKKNKEKNVKKNEEKDVQKEEEKDVQKKVEKSAKHLPQKKPESKKHEQT 335 Query: 423 KSTMEDEKLKEKISDSDK 370 K ++ KLK ++SD +K Sbjct: 336 KKDLKGRKLKRQLSDKEK 353 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = -2 Query: 528 IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKC 349 I+R+ N + Y+ E D +E + E Y S++ + KL+++I D + I C Sbjct: 569 IDRLENRLQSYQVEIDDLQEEFERDR--EDYLDSIRKQEQTIKLQQQIIDKIQPCIRRDC 626 Query: 348 N 346 N Sbjct: 627 N 627 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/85 (24%), Positives = 47/85 (55%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 358 KEE + E EK + ED+ ++E + +E+ +K +EDE K+++ + +K+T Sbjct: 642 KEEERKRREEEEKKKREDEVKREEEGRRQKVEA---ELK-LIEDEH-KQRLEELEKKTKK 696 Query: 357 DKCNDTIKWLDSNQLADKEEYEHKQ 283 ++ + +++++ D+ + E KQ Sbjct: 697 EEEKKRSEHVNNDEELDRLQEEIKQ 721 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 28.3 bits (60), Expect = 7.5 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS-----D 373 + +E +NE EK D + Q KN E C + +T E +K +++S+S + Sbjct: 805 RAHLESDINEKEKEIERKDNALKEFQEKNK-ELEC-QLAATGELKKTVDELSNSITLRDE 862 Query: 372 KQT-ILDKCNDTIKWLDSNQLADKEEYEHKQK 280 K T I ++ T++ + A KEE K+K Sbjct: 863 KITKIKEQLKQTLEKFKEKEKALKEEIAEKEK 894 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.3 bits (60), Expect = 7.5 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 7/99 (7%) Frame = -2 Query: 546 VSSKEEIERMVN------EAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEK 388 V KE +ER+ E E+Y +QKE + K + + ++KS E+ K KEK Sbjct: 110 VKEKETVERLHRQEQLQLERERYATASLTQQKEALSEKLSQITLRQNLKSHKEEAKNKEK 169 Query: 387 ISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 +S ++Q L+ + + EE +QKE+E Sbjct: 170 LS-KERQKKLENMLQSERQRCVEYQRLYEEQVLRQKEME 207 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 209 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPT 90 C A A+ P+ +VPPP APP + P TT PT Sbjct: 92 CNAKPAQ-PDTDVPPPPATTSAPPPPTTTAPP-ATTSPPT 129 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 28.3 bits (60), Expect = 7.5 Identities = 26/107 (24%), Positives = 48/107 (44%) Frame = -2 Query: 591 HQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 412 H + RS T+ ++ EE ER +E +N+D + +E + K E + Sbjct: 397 HHHKKKRSHSKTSS--TTDEEKERKKSET---KNKDSEDEEKERKKREAEE---EEERRR 448 Query: 411 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 E+E+ +E+ ++ + + K + + +EE E KQKE E Sbjct: 449 EEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKE 495 Score = 27.9 bits (59), Expect = 10.0 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -2 Query: 537 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ 367 +EE ER E K E+ KQ+E + K E + E+E+ K+K + +K+ Sbjct: 448 REEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEEERKQKEKEEEKK 499 >SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) Length = 1146 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -3 Query: 221 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 63 S + C A+ P + L+ P S S +PT TL CNN TSP Sbjct: 84 SEQYCYFGDAKVPATFMNDTTLKCTVPTSSVSSRPTVAVTLNGGCNN-FTTSP 135 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 28.3 bits (60), Expect = 7.5 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -2 Query: 522 RMVNEAEKYRNEDDKQK-ETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCN 346 R EAE+ R E +K+K E +A+ + + ++E+LK + D +++ K Sbjct: 190 RFEQEAERRRREAEKRKAEEEEARRKADELEKIKRQQEDEERLKNQRLDEERK----KLE 245 Query: 345 DTIKWLDSNQLADKEEYEHKQKELE 271 + L + KEE E K++E E Sbjct: 246 EEEANLMEEERKRKEEAEKKREEEE 270 >SB_3823| Best HMM Match : KE2 (HMM E-Value=4.4e-20) Length = 159 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = -2 Query: 594 VHQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRNEDDKQK 472 +++ + ++P+PT + S+K E + + EKYR + + K Sbjct: 97 INEMEKKQTPIPTREGDSNKSEALSVCSTCEKYREANQEMK 137 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/68 (30%), Positives = 25/68 (36%) Frame = +3 Query: 171 HLRLRVLRPGSPAYLRGLLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNPAT*WCRC 350 HL +RVL P P L LS C CLP+ +C H + P C Sbjct: 1140 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVHLSVRVLSPVCPRVFTCLY 1195 Query: 351 TCRGWSAC 374 C S C Sbjct: 1196 ACVNLSVC 1203 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/91 (20%), Positives = 42/91 (46%) Frame = -2 Query: 543 SSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 364 ++ EE E E E+ E+++Q E + + E + + E+EK + K D +++ Sbjct: 69 NNTEEEEEQTEEEEEQTEEEEEQTEEEEEQTEEEEEQ-TEEEEEEEEKEEGKEEDGEEEV 127 Query: 363 ILDKCNDTIKWLDSNQLADKEEYEHKQKELE 271 + D+ + +SN+ + E + + E Sbjct: 128 VTDERGISSSKDESNESDESNESDESNESDE 158 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = -2 Query: 534 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 370 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -2 Query: 411 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 EDE+ E SD D +T +++ +D ++ D+EE HK +E Sbjct: 118 EDEEKTESESDDDDKTEKYSDDESDVSMDGDESDDEEEGPHKPEE 162 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 27.9 bits (59), Expect = 10.0 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Frame = -3 Query: 233 VPEESPEVCRASRAEHPEPEVPP----PGLEALAPPSRRSIKPT-FHTTL--KPTCNNHL 75 VP ++P ++S A +P P+ PP A P ++ S PT +TL P+ H Sbjct: 789 VPTQAPTEMKSSTARNPPPKKPPNPTKQSATAPTPSTQGSQSPTGSASTLGENPSPTTHY 848 Query: 74 VTSP 63 T P Sbjct: 849 ATKP 852 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = -2 Query: 453 NALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 277 +AL+ Y + ++ EKLKE I D K +LD+ ++W+ + ++ + ++KE Sbjct: 852 SALDLYVLIPPANIK-EKLKEDIHDPHK--VLDRVKYRVEWVKHQEKEKQKLEDEREKE 907 >SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -2 Query: 567 PLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKE---TIQAKNALESYCFSMKSTMEDEKL 397 P+P KV ++ + V++ + N+DDK++E + E++ SM+ + D++ Sbjct: 456 PIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEETEAHIISMQEEVNDDET 515 Query: 396 KEK 388 +E+ Sbjct: 516 EEE 518 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -2 Query: 567 PLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKE---TIQAKNALESYCFSMKSTMEDEKL 397 P+P KV ++ + V++ + N+DDK++E + E++ SM+ + D++ Sbjct: 443 PIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEETEAHIISMQEEVNDDET 502 Query: 396 KEK 388 +E+ Sbjct: 503 EEE 505 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -3 Query: 185 PEPEVPPPGLEALAPPSRRS--IKPTFHTTLKPTCNNHLVTSP*LK*INIE 39 P P PPPG E PP + + PT P V+ P K N++ Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPPYKSANMD 182 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.9 bits (59), Expect = 10.0 Identities = 25/106 (23%), Positives = 40/106 (37%), Gaps = 4/106 (3%) Frame = -2 Query: 600 REVHQXXRTRSPLPTTKVVSSKEEIERMVNEAEKYRN----EDDKQKETIQAKNALESYC 433 +E + + R L K +EE R NE K R E +KQ++ K Sbjct: 151 KEEEEKEKQRKQLEVEKQKRLEEERIRSQNEERKRREREQKEREKQQKLDMEKEERRRRQ 210 Query: 432 FSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEY 295 + +E+ K K + +KQ IK Q D+++Y Sbjct: 211 QEEEKKRREEEEKRKKVEKEKQEREKAAKKNIKRQQQQQRTDQQQY 256 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -2 Query: 567 PLPTTKVVSSKEEIERMVNEAEKYRNEDDKQKE---TIQAKNALESYCFSMKSTMEDEKL 397 P+P KV ++ + V++ + N+DDK++E + E++ SM+ + D++ Sbjct: 82 PIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEETEAHIISMQEEVNDDET 141 Query: 396 KEK 388 +E+ Sbjct: 142 EEE 144 >SB_28595| Best HMM Match : Astacin (HMM E-Value=0.05) Length = 191 Score = 27.9 bits (59), Expect = 10.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 569 HHYQRQRSSLPRKRSSVWLMRQ 504 HH Q + S PR R+S+WL ++ Sbjct: 72 HHSQPAKRSAPRHRASLWLTKK 93 >SB_16304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1489 Score = 27.9 bits (59), Expect = 10.0 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 4/74 (5%) Frame = -3 Query: 305 RRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRASRAEHPEPEVPPPGL----EALAPP 138 +R + TS+ K R L+ R P + R + HP+ PP + AL Sbjct: 1159 QRQLQTSKSTTKTQLPRILQTTGRQPVVISQEPRGVKRSHPDTPEPPKVVTRIKTALMQD 1218 Query: 137 SRRSIKPTFHTTLK 96 + P FHT K Sbjct: 1219 QHSVLHPDFHTPFK 1232 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -3 Query: 185 PEPEVPPPGLE-ALAPPSRRSIKPTFH 108 P P PPP L A APP R P H Sbjct: 425 PPPPPPPPALRLACAPPRLRFTSPVLH 451 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,771,623 Number of Sequences: 59808 Number of extensions: 431014 Number of successful extensions: 2184 Number of sequences better than 10.0: 85 Number of HSP's better than 10.0 without gapping: 1839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2157 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -