BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O19 (793 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 30 0.094 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 28 0.38 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 2.0 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 6.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 24 6.2 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 6.2 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 6.2 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 8.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.2 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 29.9 bits (64), Expect = 0.094 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -3 Query: 308 TRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRASRAEHPEPEVPP 165 T RS ST N TIR R TR P P V +R P PP Sbjct: 416 TTRSTSTKLSNCSMRTIRTTVRSTRAPSPGPIVYYPARETLPRLAQPP 463 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 27.9 bits (59), Expect = 0.38 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -3 Query: 593 STXXGEQDHHYQRQRSSLPRKRSSVWLMR---QRSTETRMTSKRRPSRPRMHWN 441 ST Q HH+Q QR + R L R S KR+P PR++ N Sbjct: 108 STQQQHQQHHHQHQRFQVVRAVLHDILFRHLLDTSASAPKKKKRKPKPPRIYNN 161 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 25.4 bits (53), Expect = 2.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 552 KVVSSKEEIERMVNEAEKYRNEDDKQKETIQA 457 + VSS EE+ER E E+ R + ++ QA Sbjct: 1181 RAVSSAEELERRRREMERTRRQRQRRARDSQA 1212 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = -2 Query: 513 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 334 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 164 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNN 223 Query: 333 WLDSNQLADKEEYEHKQKE 277 L L DKE EH+Q E Sbjct: 224 SLHHGPLRDKELTEHEQLE 242 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = -2 Query: 513 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 334 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 164 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNN 223 Query: 333 WLDSNQLADKEEYEHKQKE 277 L L DKE EH+Q E Sbjct: 224 SLHHGPLRDKELTEHEQLE 242 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = -2 Query: 513 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 334 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 116 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSSNNNNNTISSNNNNNN 175 Query: 333 WLDSNQLADKEEYEHKQKE 277 L L DKE EH+Q E Sbjct: 176 SLHHGPLRDKELTEHEQLE 194 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 248 RRCTRVPEESPEVCRASRAEHPEPEVPPP 162 R+C+R SP+ A ++++ P VPPP Sbjct: 44 RKCSR--NGSPKFAPAVQSKNRMPPVPPP 70 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 8.2 Identities = 14/79 (17%), Positives = 33/79 (41%) Frame = -2 Query: 513 NEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 334 + A++Y + D + + + +++ + ++ + S ++ + N+ Sbjct: 164 SSADRYSADTDSKLRSERIRDSRDERDSLPNASSNNSNNNNNSSGNNNNNTISSNNNNNN 223 Query: 333 WLDSNQLADKEEYEHKQKE 277 L L DKE EH+Q E Sbjct: 224 SLHHGPLRDKELTEHEQLE 242 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 8.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 206 RASRAEHPEPEVPPPGLEALAPPSRRSIK 120 R H +VPPPG+E P + I+ Sbjct: 1740 RMEEGAHLSFKVPPPGIEFTLPSPKIGIE 1768 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,448 Number of Sequences: 2352 Number of extensions: 13739 Number of successful extensions: 47 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -