BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O18 (934 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 28 0.47 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 26 1.4 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 5.7 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 7.6 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 7.6 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 7.6 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 7.6 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 27.9 bits (59), Expect = 0.47 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -1 Query: 532 RTSLYKKAGWYRSGIP--RALCDIHCAGADSLSLISW 428 R+ L+K GWY G+ ALC + C G S ++ W Sbjct: 385 RSGLFKGGGWYMLGVQSLSALC-LACWGVCSTFVLLW 420 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 26.2 bits (55), Expect = 1.4 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +2 Query: 626 SVPVSSMEVKTAWMASPGDLTGSLNELCLYRPPTVHAYRPFASMGRSCYDIXESP 790 S+P + V + M+SPG TGS + RP V + P+ M + Y +P Sbjct: 157 SIPSPPITVSGSDMSSPGAPTGSSSPQITPRPTPVKS--PYEWMKKQSYQSQPNP 209 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 5.7 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 595 PRPRLESGG---WIGPGVFYGGQNSVDGVSRRSDGFTKRALLI*TSHR 729 PRPR ++ WI G FY G ++D R+ + +++ +R Sbjct: 263 PRPRPKNAAVMLWIFGGSFYSGTATLDVYDHRALASEENVIVVSLQYR 310 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.8 bits (49), Expect = 7.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 56 TLERPRPAARAHGAIVLAVGEQRLPE 133 T P+P R +G IVL + LPE Sbjct: 31 TAAAPQPVQRPYGKIVLTLENCLLPE 56 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.8 bits (49), Expect = 7.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 56 TLERPRPAARAHGAIVLAVGEQRLPE 133 T P+P R +G IVL + LPE Sbjct: 31 TAAAPQPVQRPYGKIVLTLENCLLPE 56 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 595 PRPRLESGG---WIGPGVFYGGQNSVDGVSRRSDGFTKRALLI*TSHR 729 PRPR ++ WI G FY G ++D R+ + +++ +R Sbjct: 263 PRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYR 310 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.8 bits (49), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 595 PRPRLESGG---WIGPGVFYGGQNSVDGVSRRSDGFTKRALLI*TSHR 729 PRPR ++ WI G FY G ++D R+ + +++ +R Sbjct: 149 PRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYR 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 910,073 Number of Sequences: 2352 Number of extensions: 20521 Number of successful extensions: 50 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 101708946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -