BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O13 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 2.0 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 4.6 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 4.6 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 24 6.1 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 24 6.1 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 24 6.1 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.1 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -2 Query: 644 VEKLKAISFANQVRIRIITDAEE 576 +E+L+ I A + R+R+ITD +E Sbjct: 309 LERLRGICLAARERLRLITDLQE 331 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 4.6 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 275 SFAVACFPIQT*MLPDMVSKIYAFCGLKFSCLKGFDS 385 SF++A FPI +P V+ + FCGL+ + + FD+ Sbjct: 59 SFSMA-FPINL-AVPVTVTLLLVFCGLREADVCAFDN 93 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 4.6 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +1 Query: 241 QFLSFRHGL--RFLVCGSLLPDP 303 Q L+ RH L RFL C LPDP Sbjct: 1055 QQLALRHKLVERFLPCYRYLPDP 1077 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 746 RQVDPQIASMXKGDVFVLDXDNDIYVFVGEKAKNVEK 636 ++ +PQI D F D D+D VG++ ++ E+ Sbjct: 311 KKTNPQIVEYEFDDDFPFDDDSDFDDDVGDRLESEEE 347 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 746 RQVDPQIASMXKGDVFVLDXDNDIYVFVGEKAKNVEK 636 ++ +PQI D F D D+D VG++ ++ E+ Sbjct: 81 KKTNPQIVEYEFDDDFPFDDDSDFDDDVGDRLESEEE 117 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 23.8 bits (49), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 746 RQVDPQIASMXKGDVFVLDXDNDIYVFVGEKAKNVEK 636 ++ +PQI D F D D+D VG++ ++ E+ Sbjct: 81 KKTNPQIVEYEFDDDFPFDDDSDFDDDVGDRLESEEE 117 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 564 PQYRLFRVRDDPDPYLIGERNRFKLLNVF 650 P++RL+ PYL +RN F+ L+ F Sbjct: 108 PKFRLYVGIVYVPPYLSSDRNYFESLSAF 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,351 Number of Sequences: 2352 Number of extensions: 12800 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -