BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O11 (865 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.97 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.97 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.97 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 27 0.97 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 26 1.3 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 26 1.7 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 3.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 3.9 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 24 5.2 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 5.2 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 24 6.9 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 24 6.9 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 9.1 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 26.6 bits (56), Expect = 0.97 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 661 PRIHFPLVTYAPVISAEKAYHEQLSVAEIT 572 PR+HF + +AP+ S + L+V E+T Sbjct: 157 PRLHFFMPGFAPLTSRGSQQYRALTVPELT 186 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 26.6 bits (56), Expect = 0.97 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 661 PRIHFPLVTYAPVISAEKAYHEQLSVAEIT 572 PR+HF + +AP+ S + L+V E+T Sbjct: 157 PRLHFFMPGFAPLTSRGSQQYRALTVPELT 186 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 26.6 bits (56), Expect = 0.97 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 661 PRIHFPLVTYAPVISAEKAYHEQLSVAEIT 572 PR+HF + +AP+ S + L+V E+T Sbjct: 157 PRLHFFMPGFAPLTSRGSQQYRALTVPELT 186 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 26.6 bits (56), Expect = 0.97 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 661 PRIHFPLVTYAPVISAEKAYHEQLSVAEIT 572 PR+HF + +AP+ S + L+V E+T Sbjct: 157 PRLHFFMPGFAPLTSRGSQQYRALTVPELT 186 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 26.2 bits (55), Expect = 1.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 287 LGLALTTSSTSCTPSVLSCTGTSVRVWRRESSPKPV 180 L + TTS+TS T + + T T+ ++P PV Sbjct: 138 LSMGATTSTTSTTATTTTTTTTTTTTTTTTTTPNPV 173 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.8 bits (54), Expect = 1.7 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -2 Query: 660 PVSTSHWSRTRQSSLPRRPTMNSFPSPRSQTHASSPPTRW*NATP 526 P +T+ WS + T+ + P+ + THA + T W + P Sbjct: 168 PTTTTTWSDQPRPPTTTTTTVWTDPTATTTTHAPTTTTTWSDLPP 212 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 25.0 bits (52), Expect = 3.0 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -2 Query: 660 PVSTSHWSRTRQSSLPRRPTMNSFPSPRSQTHASSPPTRW*NATP 526 P +T+ WS T+ + P+ + THA + T W + P Sbjct: 168 PTTTTTWSDQPPPPTTTTTTVWTDPTATTTTHAPTTTTTWSDLPP 212 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.6 bits (51), Expect = 3.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 615 PRRPTMNSFPSPRSQTHASSPP 550 P++P+ + P+P+ QT PP Sbjct: 385 PQQPSRPTIPAPQQQTPPRQPP 406 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 516 CHDGGSHFTIWLAGSKHAFVISATESCSW*AFSA 617 C D S+ TIWL GS+ ++ SW + A Sbjct: 421 CRDFNSN-TIWLNGSRPGLELAGRPYVSWNGWKA 453 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.2 bits (50), Expect = 5.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 162 RGQPGPHGLRRTLPPPYP 215 RG+PGP G L PP P Sbjct: 627 RGEPGPKGEPGLLGPPGP 644 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 23.8 bits (49), Expect = 6.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 206 RRESSPKPVRTWLPSRRITKKSAWTPLKARV 114 R S K V+ W +RR+ +K P A + Sbjct: 232 RLRLSEKQVKIWFQNRRVKRKKGDAPFGAEL 262 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.8 bits (49), Expect = 6.9 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 460 VHILGYDVTTVQHTASHV 513 +H + Y ++TV HTAS++ Sbjct: 733 IHTIEYVLSTVSHTASYL 750 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 9.1 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -2 Query: 366 TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFV 232 T + D+AKV+ AV + + ++ A +++ +DL A A + Sbjct: 991 TALLENDIAKVKHAVVIQNGMNYLSNQLAFINNPYDLSIATYAMM 1035 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 789,781 Number of Sequences: 2352 Number of extensions: 17067 Number of successful extensions: 77 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -