BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O05 (835 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 26 0.32 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 23 2.3 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 5.2 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 6.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 9.1 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 26.2 bits (55), Expect = 0.32 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -2 Query: 474 ERSTKRREPEKINTNRTIDITKTTNMTDTVRKRRTFTKRNTSRPG 340 ER T+RR + T +++ +TK +++ +V + R SRPG Sbjct: 29 ERVTRRRLRRPLKTTQSVSVTKDQDVSSSVNRFRL-----RSRPG 68 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -1 Query: 430 SHDRHYKNDEYDRYSSKKKDVYQEKHKSSRSSKDYDRQRYRDGSEEE 290 S D H + + + +K+ V K ++ + + +QRY E E Sbjct: 25 SKDPHLTDQQASGHKKRKRRVLFSKAQTYELERRFRQQRYLSAPERE 71 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 3.0 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = +1 Query: 166 DDGGSSWYCATVADP*TAHTYRTCRGRGAAGSATAWLASCPSPPPTRLCTFACRNPC 336 D G + A VA+ TA + G G + S P PPP L + PC Sbjct: 174 DRGRVAAAAAMVAE--TASFHHDAAGYGLRNYGPEPVPSTPYPPPGSLGSMGVSVPC 228 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 394 RYSSKKKDVYQEKHKSSRSSKD 329 R+ +KK++ ++ HKS S D Sbjct: 235 RFKDEKKELIRQTHKSPSHSVD 256 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -1 Query: 427 HDRHYKNDEYDRYSSKKKDVYQEKHKSSRSSKDYDRQR 314 H+RH+++ + S+K + K + S S + +R Sbjct: 92 HERHFESSFGNNLHSEKAKFNESKWQDSGESPGFTTER 129 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 9.1 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +1 Query: 397 HIRRFCNVYRAICIYLFWFS 456 H+ +C + +CIY F+++ Sbjct: 225 HLLFYCVLIILLCIYYFYYA 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,879 Number of Sequences: 336 Number of extensions: 2448 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22932949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -