BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O04 (897 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 24 1.9 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 4.3 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/38 (23%), Positives = 21/38 (55%) Frame = -2 Query: 323 QDPRDCGHHQPVENKPRVLLELQQGSAAVHPEVARQSV 210 Q + CG+H P+E+ +++ + + ++P V S+ Sbjct: 34 QGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQGSSL 71 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 4.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 212 LTDEPLLDELLRILAEAQEELAV 280 L++E LLDELLR E + L V Sbjct: 260 LSEEVLLDELLRHFPERIQSLWV 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,383 Number of Sequences: 336 Number of extensions: 2053 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -