BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O02 (811 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.2 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 25 3.7 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.2 bits (55), Expect = 1.2 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 610 YSETRSFMLLSASVNSISSMPSPXYQCKKALR-LNIAXN 723 + +TR+ +L S N+I S+P + LR LNI+ N Sbjct: 167 FGQTRNLEVLDLSTNNIWSLPDHLFCSLSGLRSLNISSN 205 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 322 VKEKHRECKHNLLPRHN 372 V+EK REC +L +HN Sbjct: 326 VQEKGRECVREILQKHN 342 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,175 Number of Sequences: 2352 Number of extensions: 12377 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -