BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_O01 (788 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 25 0.69 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 2.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 4.9 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 22 4.9 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 22 4.9 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 22 4.9 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 6.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 6.4 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 25.0 bits (52), Expect = 0.69 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = -1 Query: 578 RRLLDPAHTQERLRDSVDGLRRSSSRADLPGHGGHHCHGQ---VN*HREGDRSTHH 420 RR+ + ++Q + + +++ + H GHH H Q VN H + S H Sbjct: 294 RRMKNKKNSQRQAAQQQNNNNAATNNQNHHHHAGHHIHAQHHVVNHHVAANGSLKH 349 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 573 PPGMMASRLSXPPVTPPACLSMSSLXRDAHLLL 671 PP L PP+ PP ++ S++ A L+ Sbjct: 175 PPLPQVPPLPLPPIFPPTMINPSAICESAAQLI 207 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 503 RADLPGHGGHHCH 465 RAD PG+ HCH Sbjct: 660 RADNPGYWLFHCH 672 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 382 CREGVSWMNKIIYRFV 335 C E W NK+I +F+ Sbjct: 177 CVENRKWQNKVIQKFL 192 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 382 CREGVSWMNKIIYRFV 335 C E W NK+I +F+ Sbjct: 410 CVENRKWQNKVIQKFL 425 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 382 CREGVSWMNKIIYRFV 335 C E W NK+I +F+ Sbjct: 410 CVENRKWQNKVIQKFL 425 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 266 RVPFDLFRN 292 RVPFDLF N Sbjct: 335 RVPFDLFEN 343 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 Query: 693 REHAVHRGGGDEHPAXRSSLRGTRAESPA 607 R H VH G E A R+ RA A Sbjct: 259 RHHLVHHKCGGEEEAERAPAPAVRAAGDA 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,345 Number of Sequences: 336 Number of extensions: 3676 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -