BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N24 (860 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) 29 4.9 SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) 28 8.5 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 28 8.5 >SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) Length = 4240 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 463 INHNHLREYLPVLKYENIR*STLDWTMVC 549 INH REY +K N+ + DW VC Sbjct: 4128 INHGKFREYSRAVKAANLMRNGKDWNTVC 4156 >SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) Length = 829 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +3 Query: 309 LMKLFTKNTNISLHVNVQFAVMECFCSHSYYVKQKLGSYIMLLKFCSFCFLY 464 L K NT+ +H N ++ C+ S Y L Y +LL FC+ F+Y Sbjct: 285 LKKQINCNTDHIIHEN--YSRFTCYNVLSSYFSVTLCIYYILLVFCAVIFVY 334 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 68 IITNPGRLLKHNHATDNSYCISLNYL 145 ++ PGRLL+H T N C SL L Sbjct: 175 VVCTPGRLLQHMDETPNFDCTSLQIL 200 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,673,907 Number of Sequences: 59808 Number of extensions: 373152 Number of successful extensions: 600 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -