BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N24 (860 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.3 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 9.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 1.3 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 273 FSKSSLPFNIYNLMKLFTKNTNISLHVNVQ 362 F K + N N+++LF +N +HVN+Q Sbjct: 337 FLKLAQKHNFTNVLQLFLHTSNGLIHVNIQ 366 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.4 bits (48), Expect = 9.0 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 603 WPFRRSRCASYHVVNIFDTYHCPIQGALSYIFI 505 WP RRSR + + C +LS++F+ Sbjct: 34 WPSRRSRLCIIALSLTLSSSSCKQSTSLSFVFL 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,135 Number of Sequences: 2352 Number of extensions: 13772 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -