BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N23 (885 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 31 0.062 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 27 1.0 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 25 3.1 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 25 3.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 9.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 30.7 bits (66), Expect = 0.062 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = -1 Query: 342 CSPSPCRNNASCVESAAD-VTCV-CRDGYTG 256 C PC NN +C++ A D V C+ C GY G Sbjct: 773 CKRCPCPNNGACMQMAGDTVICLECPVGYFG 803 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 26.6 bits (56), Expect = 1.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 351 VSRCSPSPCRNNASCVESAADVTC 280 VS CSP ++ASC SAA C Sbjct: 235 VSSCSPLSTASSASCSSSAAGSLC 258 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 25.0 bits (52), Expect = 3.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 191 CCLRPVIVNIMYFYCK 144 CCLRP +N + YCK Sbjct: 140 CCLRPCGMNQLLQYCK 155 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 25.0 bits (52), Expect = 3.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 191 CCLRPVIVNIMYFYCK 144 CCLRP +N + YCK Sbjct: 140 CCLRPCGMNQLLQYCK 155 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 9.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 282 CVCRDGYTGKTYSC 241 C CR+G+TG C Sbjct: 616 CECREGWTGPACDC 629 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 585,018 Number of Sequences: 2352 Number of extensions: 8093 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -