BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N20 (894 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024751-7|AAK21507.2| 1258|Caenorhabditis elegans Hypothetical ... 29 4.5 Z81128-4|CAB03403.1| 898|Caenorhabditis elegans Hypothetical pr... 28 7.8 >AC024751-7|AAK21507.2| 1258|Caenorhabditis elegans Hypothetical protein Y18H1A.3 protein. Length = 1258 Score = 29.1 bits (62), Expect = 4.5 Identities = 23/69 (33%), Positives = 35/69 (50%) Frame = +2 Query: 593 PSRGLG*SPEAGSVPVSSMEVKTAWMASPGDLTXH*TSSAYIDLPPYTPTAHLRQWGGXC 772 PSRG SP G+ +SM ++T+ P L +S+A+ LP +TP A L +W Sbjct: 959 PSRGSP-SPVDGAAQFTSM-IETS-RRQPQPLGT--SSAAHDHLPAFTPNAKLLEWRSLS 1013 Query: 773 YDIWKXPLI 799 + PL+ Sbjct: 1014 ASLGFVPLV 1022 >Z81128-4|CAB03403.1| 898|Caenorhabditis elegans Hypothetical protein T23D8.4 protein. Length = 898 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 604 PRLESGGWIGPGVFYGGQNSVDGVSRRSDG 693 PR GG+ GPG ++ G+N G ++ G Sbjct: 833 PRTGRGGYQGPGSWFPGRNERQGDKQKGSG 862 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,209,830 Number of Sequences: 27780 Number of extensions: 367728 Number of successful extensions: 772 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2265843888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -