BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N19 (775 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81540-7|CAB04399.1| 134|Caenorhabditis elegans Hypothetical pr... 29 2.8 Z70287-8|CAA94301.2| 1717|Caenorhabditis elegans Hypothetical pr... 28 8.5 >Z81540-7|CAB04399.1| 134|Caenorhabditis elegans Hypothetical protein F46B3.8 protein. Length = 134 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 7/56 (12%) Frame = -2 Query: 312 PLVVRDQVCVPSY-----GFRNLPGMLSWCQ--TNCLRYPPNCPEALCSCPQVCEA 166 P+ + C P Y G+ N+P WC T Y P PE +C+ +C A Sbjct: 24 PITPKCSSCSPVYETGCMGY-NMPTTTDWCAIVTVTYTYTPGLPEDMCTANVICPA 78 >Z70287-8|CAA94301.2| 1717|Caenorhabditis elegans Hypothetical protein R09E10.7 protein. Length = 1717 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 243 WCQTNCLRYPPNCPEALCSCPQVCEAV 163 W QT+C + P + A +C Q+C+ + Sbjct: 450 WAQTSCFKVPNSQMLAQLNCSQLCDEI 476 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,645,530 Number of Sequences: 27780 Number of extensions: 368079 Number of successful extensions: 1092 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -