BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N09 (795 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 26 0.40 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 26 0.40 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 25 0.92 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.5 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 25.8 bits (54), Expect = 0.40 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 6/42 (14%) Frame = -3 Query: 415 VSWRLISLWENNNVIFKILN------TEHEMYLKLDVNVDRY 308 ++WR+ W NV+ KI+ T Y+ + +++DRY Sbjct: 104 IAWRITVAWYAGNVLCKIIRFLQAVVTYSSTYVLVALSIDRY 145 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 25.8 bits (54), Expect = 0.40 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 91 HNPAVAVKPFYI*PCYNKLYH 29 HNPA + P Y P YN Y+ Sbjct: 23 HNPAYSPPPSYCDPWYNPYYY 43 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 24.6 bits (51), Expect = 0.92 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 126 GTVADN-PEYYGFIIQPWQ*NPSTSDHVIINFITA 25 G A+N P Y+G PWQ + ++N++ A Sbjct: 212 GIAAENSPLYWGGADTPWQREYENVNSTVVNWVNA 246 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -2 Query: 449 LGRWKRLHQLPSQ--LATHLSLGKQQRHLQDTEHRTRDVLETGRERG 315 L R ++L P L SLG +R + + +T D+ E +E+G Sbjct: 489 LARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLDEIQKEKG 535 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -2 Query: 449 LGRWKRLHQLPSQ--LATHLSLGKQQRHLQDTEHRTRDVLETGRERG 315 L R ++L P L SLG +R + + +T D+ E +E+G Sbjct: 489 LARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLDEIQKEKG 535 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -2 Query: 449 LGRWKRLHQLPSQ--LATHLSLGKQQRHLQDTEHRTRDVLETGRERG 315 L R ++L P L SLG +R + + +T D+ E +E+G Sbjct: 489 LARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLDEIQKEKG 535 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.5 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -2 Query: 449 LGRWKRLHQLPSQ--LATHLSLGKQQRHLQDTEHRTRDVLETGRERG 315 L R ++L P L SLG +R + + +T D+ E +E+G Sbjct: 489 LARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLDEIQKEKG 535 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,680 Number of Sequences: 336 Number of extensions: 4022 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -