BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N09 (795 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 26 0.46 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 5.7 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 5.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.7 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 10.0 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 10.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 10.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 10.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 10.0 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.8 bits (54), Expect = 0.46 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 136 PHKAVPXTGPRSRPASGPAGTPDSQ*GTAVGRPPSPGIN 252 P + P + P GP G P SQ + + P+ GI+ Sbjct: 34 PQRGSPPNPSQGPPPGGPPGAPPSQNPSQMMISPASGIH 72 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/29 (31%), Positives = 11/29 (37%) Frame = +3 Query: 588 WPSCHNLYANDMAFLMPCETSRETTSRQT 674 WP C + + AFL T R T Sbjct: 285 WPGCEVICEDYQAFLKHLNTEHTLDDRST 313 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 3.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -3 Query: 478 NVDRYKDRLTWGDGKDYTSYRVSWRLISLWENNNVIFKILNTE 350 N + +KD+ W D + + + ++ + N + FKI TE Sbjct: 489 NTEIFKDKSDWFDYSEVSKWVQKGQICLKEKENEIDFKIEVTE 531 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -3 Query: 385 NNNVIFKILNTEHEMYLKLDVNVDRYGDRKTWGSNDSSEKRH 260 N NV+ LN EH + L NV+ + D+ + H Sbjct: 383 NQNVLNNDLNLEHVNFQILGANVNDLIRNSRCANFDNQDNNH 424 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/18 (50%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = +3 Query: 261 CLFSLESFDPQV-FLSPY 311 C+ S ES++PQV F++ Y Sbjct: 114 CILSSESYNPQVDFVADY 131 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 540 SMSWNSLGK*SSTMSLWPSCHNLY 611 ++S NSLG S + SCH+ Y Sbjct: 211 AISSNSLGSRSRSFQRTSSCHSRY 234 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 386 KQQRHLQDTEHRTRDVLETGRERGQIWRQED 294 K Q QDT T+ +L+ IW+Q++ Sbjct: 927 KWQHKSQDTTEVTKYILQYKEGDAGIWQQQE 957 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 386 KQQRHLQDTEHRTRDVLETGRERGQIWRQED 294 K Q QDT T+ +L+ IW+Q++ Sbjct: 923 KWQHKSQDTTEVTKYILQYKEGDAGIWQQQE 953 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 10.0 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 638 LRDEPRDDVATDAGXLVVVXAAHSLHRVDVXPARN 742 +RD + + G VV +H+L+++D RN Sbjct: 126 VRDHNISALCKELGISVVQKVSHTLYKLDEIIERN 160 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 10.0 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 295 TWGSNDSSEKRHTWYLYPVKVGDQQL--FLIENREYRQGLKLDA 170 +W NDS H ++ + + G+ + F + ++ GL L A Sbjct: 203 SWAKNDSWRITHNFFYFDPRYGNYNINGFNFQWKDGLFGLSLSA 246 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 10.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 Query: 28 SDKVYYNMVRCRRVSLP 78 S K+YYN++ ++ +P Sbjct: 320 SKKLYYNIINIEQIPVP 336 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 10.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 Query: 28 SDKVYYNMVRCRRVSLP 78 S K+YYN++ ++ +P Sbjct: 331 SKKLYYNIINIEQIPVP 347 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 10.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 371 LQDTEHRTRDVLETGRERG 315 LQD E+ R + T RERG Sbjct: 468 LQDREYCPRYIKWTNRERG 486 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,057 Number of Sequences: 438 Number of extensions: 5378 Number of successful extensions: 16 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -