BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N08 (802 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0523 + 18310695-18311837,18312050-18312109,18312232-183123... 30 2.5 01_06_1506 + 37830468-37830600,37830703-37830920,37832078-378325... 28 9.9 >09_04_0523 + 18310695-18311837,18312050-18312109,18312232-18312324, 18312675-18312731,18313321-18313359 Length = 463 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 285 KCLKLQSIAKNAKRTHENMV-YGFHGLRLTFIIFHFILDSKVH 160 +C+ L +N+K H + +GFH + + + HF+ D +H Sbjct: 135 ECMHLVKPVRNSKTDHFSYYSFGFHPVTKQYKVMHFLRDEHLH 177 >01_06_1506 + 37830468-37830600,37830703-37830920,37832078-37832529, 37832595-37833402,37834986-37835073,37835196-37835299, 37835402-37835483,37836670-37836923 Length = 712 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 500 SIYTFYTQKFHFYPPKFHFTPFGVI 426 +I+ T+ + FYPPK PFG + Sbjct: 230 AIFLIGTRSYRFYPPKSKGNPFGEV 254 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,296,275 Number of Sequences: 37544 Number of extensions: 375281 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -