BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N08 (802 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00049-2|AAC47052.2| 327|Caenorhabditis elegans Serpentine rece... 28 6.8 AF125952-2|AAD14700.1| 478|Caenorhabditis elegans Hypothetical ... 28 6.8 AC006722-8|AAK68418.2| 478|Caenorhabditis elegans Hypothetical ... 28 6.8 >U00049-2|AAC47052.2| 327|Caenorhabditis elegans Serpentine receptor, class g (gamma)protein 2 protein. Length = 327 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -3 Query: 668 YYPMAKNKKKTKSLLF----SIFHI-IAHMIIWKEKNIYIFVSFH 549 Y P+A+N K ++ ++ H I ++++WK +N+Y+ SF+ Sbjct: 25 YSPLAENLKYLVQFVYLLPAAMLHARILYILLWKHRNLYLKQSFY 69 >AF125952-2|AAD14700.1| 478|Caenorhabditis elegans Hypothetical protein C01B4.8 protein. Length = 478 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 578 FLSKLSCGL*YERC*KEAISFFFCSSPWGNINLXKIFG 691 FL+ LSC + IS F C S WG ++ +FG Sbjct: 176 FLAVLSCAFQWSNVICMPISGFLCESSWGWRSIYYLFG 213 >AC006722-8|AAK68418.2| 478|Caenorhabditis elegans Hypothetical protein Y19D10A.5 protein. Length = 478 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 578 FLSKLSCGL*YERC*KEAISFFFCSSPWGNINLXKIFG 691 FL+ LSC + IS F C S WG ++ +FG Sbjct: 176 FLAVLSCAFQWSNVICMPISGFLCESSWGWRSIYYLFG 213 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,307,287 Number of Sequences: 27780 Number of extensions: 391564 Number of successful extensions: 881 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1956310428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -