BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_N06 (862 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118292-1|AAM48321.1| 262|Drosophila melanogaster GH01164p pro... 29 8.2 AE014297-1053|AAF54462.1| 262|Drosophila melanogaster CG16904-P... 29 8.2 >AY118292-1|AAM48321.1| 262|Drosophila melanogaster GH01164p protein. Length = 262 Score = 29.1 bits (62), Expect = 8.2 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 754 SVSQPLPSDHVLLDTKTTLVTYF*LNKVL-YNDSIIYCFIK 635 S Q LP DH L T+ TL + LNKVL D+I + K Sbjct: 86 SCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRK 126 >AE014297-1053|AAF54462.1| 262|Drosophila melanogaster CG16904-PA protein. Length = 262 Score = 29.1 bits (62), Expect = 8.2 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 754 SVSQPLPSDHVLLDTKTTLVTYF*LNKVL-YNDSIIYCFIK 635 S Q LP DH L T+ TL + LNKVL D+I + K Sbjct: 86 SCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRK 126 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,025,749 Number of Sequences: 53049 Number of extensions: 602196 Number of successful extensions: 878 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4147514904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -