BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M23 (817 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 24 4.9 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 6.4 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 23 8.5 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 24.2 bits (50), Expect = 4.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 336 NGGSDYVEGGFLADGHSLTAEERAF 262 NG +VEGG + GH T RAF Sbjct: 369 NGYFLFVEGGRIDHGHHYTQPIRAF 393 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 6.4 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -2 Query: 627 YTQLEDSQGGRIKTLG--ESLCKVFLHLLDTDK 535 YT++E GR+K LG F H LD K Sbjct: 110 YTRMETDMPGRVKMLGMFNDRFPRFAHQLDLSK 142 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 23.4 bits (48), Expect = 8.5 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 16/87 (18%) Frame = +1 Query: 163 FRIHSSLPRVVLKLLQYIVV-----YGLVLVRRQVALQEGALLGGQRVTV---RQETALY 318 + ++L + + LQY+V L L V Q +LL + VTV +QE Y Sbjct: 68 YETKAALANEIGEHLQYLVTSRPTAVNLKLAADDVKGQVESLLANETVTVDGMKQEAIEY 127 Query: 319 VIRPAV--------HAANVLVRGVGEP 375 ++ + + ANVLV+GV P Sbjct: 128 MLEKDISDNRAIGDNGANVLVKGVDRP 154 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,305 Number of Sequences: 2352 Number of extensions: 13131 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -