BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M22 (822 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) 29 3.4 SB_42279| Best HMM Match : WD40 (HMM E-Value=2.2e-10) 29 3.4 SB_50518| Best HMM Match : 7tm_1 (HMM E-Value=7.8e-32) 29 6.0 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 433 SCCVFIFVFWKFRWELSMWWI*VNIRFSLFKFMFCYTTTGGQAR 302 SCC+ IF FRW S+ + N R LF + GG+ + Sbjct: 49 SCCLNIFTGSPFRWSFSLHFTVCNSRKKLFSNTWAVQIEGGKTQ 92 >SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) Length = 453 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 165 VVTVENARTGTTILSLTATKHTRVLVSRAEHAVVSTSSVHLPP 293 V T+ +TG L++ AT++T +++ A+ STS PP Sbjct: 284 VATIRLKKTGFHALAVIATQNTNSRTDQSQGAISSTSEAIAPP 326 >SB_42279| Best HMM Match : WD40 (HMM E-Value=2.2e-10) Length = 291 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 165 VVTVENARTGTTILSLTATKHTRVLVSRAEHAVVSTSSVHLPP 293 V T+ +TG L++ AT++T +++ A+ STS PP Sbjct: 122 VATIRLKKTGFHALAVIATQNTNSRTDQSQGAISSTSEAIAPP 164 >SB_50518| Best HMM Match : 7tm_1 (HMM E-Value=7.8e-32) Length = 375 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 56 NSKTILLVVVFLKVCWFVCVVPL 124 ++KT+ L +V L V FVCV+PL Sbjct: 134 SNKTVYLTIVSLWVIAFVCVIPL 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,746,744 Number of Sequences: 59808 Number of extensions: 365033 Number of successful extensions: 879 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -