BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M20 (887 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 31 1.2 SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 31 1.2 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 31 1.2 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 31 1.2 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 31 1.2 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 31 1.2 SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 31 1.2 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) 31 1.2 SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) 31 1.2 SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 31 1.2 SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) 31 1.2 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 31 1.2 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 31 1.2 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 31 1.2 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 31 1.2 SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) 31 1.2 SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) 31 1.2 SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 31 1.2 SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 31 1.2 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 31 1.2 SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) 31 1.2 SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 28 8.8 SB_7966| Best HMM Match : DNA_ligase_A_C (HMM E-Value=4.8) 28 8.8 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 116 RNHGHSCFLCEIVI 129 >SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) Length = 71 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 46 RNHGHSCFLCEIVI 59 >SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 80 RNHGHSCFLCEIVI 93 >SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 51 RNHGHSCFLCEIVI 64 >SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 32 RNHGHSCFLCEIVI 45 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 215 RNHGHSCFLCEIVI 228 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 264 RNHGHSCFLCEIVI 277 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 118 RNHGHSCFLCEIVI 131 >SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 62 RNHGHSCFLCEIVI 75 >SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 47 RNHGHSCFLCEIVI 60 >SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 71 RNHGHSCFLCEIVI 84 >SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 81 RNHGHSCFLCEIVI 94 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 193 RNHGHSCFLCEIVI 206 >SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 76 RNHGHSCFLCEIVI 89 >SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 48 RNHGHSCFLCEIVI 61 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 112 RNHGHSCFLCEIVI 125 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 134 RNHGHSCFLCEIVI 147 >SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 63 RNHGHSCFLCEIVI 76 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 130 RNHGHSCFLCEIVI 143 >SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 133 RNHGHSCFLCEIVI 146 >SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 35 RNHGHSCFLCEIVI 48 >SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) Length = 77 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 52 RNHGHSCFLCEIVI 65 >SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 77 RNHGHSCFLCEIVI 90 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 175 RNHGHSCFLCEIVI 188 >SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 64 RNHGHSCFLCEIVI 77 >SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) Length = 64 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 39 RNHGHSCFLCEIVI 52 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 223 RNHGHSCFLCEIVI 236 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 170 RNHGHSCFLCEIVI 183 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 166 RNHGHSCFLCEIVI 179 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 142 RNHGHSCFLCEIVI 155 >SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 78 RNHGHSCFLCEIVI 91 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 199 RNHGHSCFLCEIVI 212 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 155 RNHGHSCFLCEIVI 168 >SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 16 RNHGHSCFLCEIVI 29 >SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 63 RNHGHSCFLCEIVI 76 >SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 42 RNHGHSCFLCEIVI 55 >SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 129 RNHGHSCFLCEIVI 142 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 139 RNHGHSCFLCEIVI 152 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 105 RNHGHSCFLCEIVI 118 >SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) Length = 181 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 156 RNHGHSCFLCEIVI 169 >SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) Length = 166 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 141 RNHGHSCFLCEIVI 154 >SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 63 RNHGHSCFLCEIVI 76 >SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 104 RNHGHSCFLCEIVI 117 >SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) Length = 148 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 123 RNHGHSCFLCEIVI 136 >SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 121 RNHGHSCFLCEIVI 134 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 127 RNHGHSCFLCEIVI 140 >SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 36 RNHGHSCFLCEIVI 49 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 115 RNHGHSCFLCEIVI 128 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 132 RNHGHSCFLCEIVI 145 >SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 80 RNHGHSCFLCEIVI 93 >SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 74 RNHGHSCFLCEIVI 87 >SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 41 RNHGHSCFLCEIVI 54 >SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 22 RNHGHSCFLCEIVI 35 >SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 31 RNHGHSCFLCEIVI 44 >SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 105 RNHGHSCFLCEIVI 118 >SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) Length = 194 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 169 RNHGHSCFLCEIVI 182 >SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 57 RNHGHSCFLCEIVI 70 >SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 35 RNHGHSCFLCEIVI 48 >SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 130 RNHGHSCFLCEIVI 143 >SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 47 RNHGHSCFLCEIVI 60 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 160 RNHGHSCFLCEIVI 173 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 662 RNHGHSCFLCEIVI 675 >SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 547 RPNGHSCFLCEIVI 588 R +GHSCFLCEIVI Sbjct: 86 RNHGHSCFLCEIVI 99 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 372 GCNFVMLDTLSLINIICPPTYQ**RIRASTMDITQCSRNSG 494 GC+ L+ + + +CPP ++ + + DI +C N G Sbjct: 335 GCSHTCLNLIGGYSCLCPPGFELSLDKRTCTDINECGYNRG 375 >SB_7966| Best HMM Match : DNA_ligase_A_C (HMM E-Value=4.8) Length = 199 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 224 GRSHAGGESYAFGAESRRRLA--LISDRECP 138 G H+GG Y F E+ RR A L ++ CP Sbjct: 44 GGYHSGGAGYVFSKETLRRFAKLLKDEKRCP 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,225,199 Number of Sequences: 59808 Number of extensions: 569628 Number of successful extensions: 1169 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -