BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M18 (832 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61550.1 68414.m06934 S-locus protein kinase, putative simila... 30 1.6 At1g61430.1 68414.m06922 S-locus protein kinase, putative simila... 28 8.7 >At1g61550.1 68414.m06934 S-locus protein kinase, putative similar to receptor protein kinase [Ipomoea trifida] gi|836954|gb|AAC23542; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 802 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +3 Query: 207 IISLPKGLKCYHTFVPRYTESNER*N----CVYASVLFCKSS 320 ++S+P KC+ FVP+++E +R N CV + L C+ + Sbjct: 290 VMSIPPKCKCFKGFVPQFSEEWKRGNWTGGCVRRTELLCQGN 331 >At1g61430.1 68414.m06922 S-locus protein kinase, putative similar to receptor protein kinase [Ipomoea trifida] gi|836954|gb|AAC23542; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 806 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = +3 Query: 207 IISLPKGLKCYHTFVPRYTESNER*N----CVYASVLFCKSS 320 ++S+P KC+ FVP++ + ++ N CV + L C+ + Sbjct: 294 VVSIPPKCKCFKGFVPKFAKEWKKGNWTSGCVRRTELHCQGN 335 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,270,446 Number of Sequences: 28952 Number of extensions: 296935 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -