BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M13 (773 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38160.2 68417.m05388 mitochondrial transcription termination... 28 6.0 >At4g38160.2 68417.m05388 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 363 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = -1 Query: 602 EFYEHGLIYTREVLFRTLKMN*SDLLFIEIKNKRYKPFNVRRFLLSKDFFCN 447 EF+ HGL E F+ +K N D E+ + K F+ +F S+ F CN Sbjct: 283 EFFHHGLKKKVESRFKLVKKNNIDCSLREMLDCNTKKFH-EKFGFSEVFNCN 333 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,326,366 Number of Sequences: 28952 Number of extensions: 235243 Number of successful extensions: 461 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -