BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M12 (841 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.08c |arc3|arc21|ARP2/3 actin-organizing complex subunit... 26 5.8 SPBC1685.11 |rlp1||RecA family ATPase Rlp1|Schizosaccharomyces p... 26 7.6 >SPBC1778.08c |arc3|arc21|ARP2/3 actin-organizing complex subunit Arc21|Schizosaccharomyces pombe|chr 2|||Manual Length = 174 Score = 26.2 bits (55), Expect = 5.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 274 FTRLTDIERTGNVAVIGILVKLR 342 F LTD+ TGN+A++ + K R Sbjct: 8 FLSLTDVPTTGNIAMLPLKTKFR 30 >SPBC1685.11 |rlp1||RecA family ATPase Rlp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 276 KKKIPINCRLSPKELPSMDRFFRRMCLSKL 187 K+ +PI C+ E + RF+ C+SKL Sbjct: 305 KQHLPIQCKRFRSERRANARFYLENCVSKL 334 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,087,986 Number of Sequences: 5004 Number of extensions: 59420 Number of successful extensions: 118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 414453330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -