BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M10 (836 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41219| Best HMM Match : EF1G (HMM E-Value=3.3e-38) 94 1e-19 SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 52 4e-07 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 30 2.7 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 28 8.2 >SB_41219| Best HMM Match : EF1G (HMM E-Value=3.3e-38) Length = 90 Score = 93.9 bits (223), Expect = 1e-19 Identities = 40/74 (54%), Positives = 53/74 (71%), Gaps = 2/74 (2%) Frame = -1 Query: 737 TKXKXIPYFWEXFDPXXYSNWYAEYK--YPXELXKVFMSCNLITGMFQRLDKMRKQAFAS 564 T+ K IPYFWE FD YS W+ EYK Y +L VFM+CNL+ GM QRL+K+ K F S Sbjct: 17 TESKAIPYFWENFDKEGYSLWFLEYKEEYEKDLGMVFMACNLVGGMIQRLEKLVKNGFGS 76 Query: 563 VCLFGEDNNSTISG 522 +C+FGE++N +I+G Sbjct: 77 ICIFGENHNCSIAG 90 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 52.4 bits (120), Expect = 4e-07 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -1 Query: 485 LSSDWQVDYESYDWKKLDPSSEETKKLVQDYF-SWNGTDKDGRKFNQGKIFK 333 L+ DW VD SY ++L+P KKL++DYF G+KFNQGK+FK Sbjct: 152 LNEDWNVDAPSYTSRRLNPDDPADKKLIEDYFIQREELTYRGKKFNQGKVFK 203 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -2 Query: 403 SRTTSRGTEPTKTVESSTRARYSSECRPTSSQ 308 SRT SRG EPTKT S + AR R +S Q Sbjct: 668 SRTLSRGREPTKTSLSKSPARPGVAKRSSSLQ 699 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -2 Query: 424 ARRPRNLSRTTS--RGTEPTKTVESSTRARYSSECRPTSSQC 305 ARR + LSR+TS RG+ ++ E S R R +E R +S C Sbjct: 1164 ARRSKQLSRSTSDPRGSLSSERPERSRRRRTETEPRDSSLPC 1205 >SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 889 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 496 SSFPRHTHTPEMVELLSSPNRQTDAKACLR 585 S+ PR + E + LL P + DA+AC+R Sbjct: 413 SAIPRSRRSFESLPLLQQPTSRRDARACVR 442 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 373 TKTVESSTRARYSSECRP-TSSQCIHISYNNY 281 TK +S+ RA EC T ++CI +SYN+Y Sbjct: 215 TKPTKSNQRAICCDECGQWTHAKCISMSYNSY 246 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -2 Query: 430 LRARRPRNLSRTTSRGTEPTKTVESSTRA--RYSSECRPTSSQ 308 LR +RPR SR G + ++ + SSEC PTSS+ Sbjct: 595 LREKRPRGQSRENRNGVFVFPSTDNGLQGITSDSSECTPTSSE 637 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,887,072 Number of Sequences: 59808 Number of extensions: 512996 Number of successful extensions: 1495 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1488 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2359470773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -