BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_M06 (856 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 24 1.3 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 24 1.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.3 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 9.4 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 9.4 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 9.4 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 361 LLFYLFYCF 335 LLFYLFYC+ Sbjct: 15 LLFYLFYCY 23 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 361 LLFYLFYCF 335 LLFYLFYC+ Sbjct: 15 LLFYLFYCY 23 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.3 Identities = 14/58 (24%), Positives = 22/58 (37%) Frame = -1 Query: 601 FIRAAESDPSLVSLALGQDLTALGLNLNSPDNLNLTFAGPWADTPCRPQDMDYHVPPE 428 ++ +A PS + G D+ L NL+ + F G W + YH E Sbjct: 1556 YLLSAAVSPSKTVIDAGYDVPVLAQNLDWVAVMTYDFHGQWDKQTGHVAPLYYHPEDE 1613 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 475 DTPCRPQDMDYHVPPEYLINGSIREK 398 +TP P D + V P GSI K Sbjct: 320 ETPGMPNDFEEFVHPTVAKRGSITSK 345 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 475 DTPCRPQDMDYHVPPEYLINGSIREK 398 +TP P D + V P GSI K Sbjct: 322 ETPGMPNDFEEFVHPTVAKRGSITSK 347 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 475 DTPCRPQDMDYHVPPEYLINGSIREK 398 +TP P D + V P GSI K Sbjct: 322 ETPGMPNDFEEFVHPTVAKRGSITSK 347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,064 Number of Sequences: 336 Number of extensions: 3615 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -