BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L21 (804 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 25 0.53 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 6.6 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 6.6 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 25.4 bits (53), Expect = 0.53 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 599 WSSQAVXTLQALSRALRQWSCFSKNLTSFELP 694 WSS TLQ+ + SC+S+++ SF LP Sbjct: 20 WSSGPNATLQSSACTDDLSSCWSEDMGSFSLP 51 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 336 PLSKRMAMLGDGDSTSRTHNSQFNHPYGYQPPVQTADDIAAQPPPRSQA 190 P ++ M+ G + H H QPP+Q + QPP + A Sbjct: 181 PHHQQQHMMYGGQQGANMHQQGPPHQ---QPPIQQQPNQGQQPPGNTAA 226 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 336 PLSKRMAMLGDGDSTSRTHNSQFNHPYGYQPPVQTADDIAAQPPPRSQA 190 P ++ M+ G + H H QPP+Q + QPP + A Sbjct: 183 PHHQQQHMMYGGQQGANMHQQGPPHQ---QPPIQQQPNQGQQPPGNTAA 228 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,299 Number of Sequences: 336 Number of extensions: 2294 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -