BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L21 (804 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr... 27 2.4 SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Sc... 27 2.4 SPBC16C6.07c |rpt1||19S proteasome regulatory subunit Rpt1|Schiz... 27 3.1 SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Sch... 26 7.2 SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyc... 25 9.5 >SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr 3|||Manual Length = 1516 Score = 27.5 bits (58), Expect = 2.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 204 PRSQADIDYELKVRKFLEMTKEDSDYEEKVRNFLA 100 P + ++ L+ K L+ K+D +Y +VR+F A Sbjct: 1360 PEAYLQLEELLQTSKILQFVKDDPNYVARVRDFYA 1394 >SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 935 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 261 PYGYQPPVQTADDIAAQPPPRSQADIDYELKVRK 160 PY Q + AQ PP Q+DI +L+++K Sbjct: 687 PYDLPSSSQISSSALAQLPPSMQSDIQQQLRLQK 720 >SPBC16C6.07c |rpt1||19S proteasome regulatory subunit Rpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 27.1 bits (57), Expect = 3.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 252 YQPPVQTADDIAAQPPPRSQADID 181 YQ PV T ++ PPP + DI+ Sbjct: 10 YQKPVDTEEENDKNPPPLDEGDIE 33 >SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1108 Score = 25.8 bits (54), Expect = 7.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 678 VRFFEKQDHCLKALDRACRVXTAWLDQGAKSYEMKE 571 V F+E D L LDR V WL G + E+ E Sbjct: 892 VIFYETMDVSLSDLDRKRLVRLRWLVDGLANIELVE 927 >SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 25.4 bits (53), Expect = 9.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 23 SCSGIGGCCCWPSSCILRLR 82 S SG+G CW S C+ +R Sbjct: 439 SISGLGTLFCWGSICLAHIR 458 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,220,078 Number of Sequences: 5004 Number of extensions: 35835 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -