BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L21 (804 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y18448-1|CAA77176.1| 3851|Homo sapiens Bassoon protein protein. 31 4.9 AF052224-1|AAC83555.1| 3926|Homo sapiens neuronal double zinc fi... 31 4.9 >Y18448-1|CAA77176.1| 3851|Homo sapiens Bassoon protein protein. Length = 3851 Score = 31.1 bits (67), Expect = 4.9 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -1 Query: 306 DGDSTSRTHNSQFNHPYGYQPPVQTADDIAAQPPPRSQADIDYELKVRKFLEMTKEDSDY 127 D +S SQ H Y + QPP R+ D + R+ LEM+ E+ + Sbjct: 723 DTAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARAAELTDEDFMRRQILEMSAEEDNL 782 Query: 126 EE 121 EE Sbjct: 783 EE 784 >AF052224-1|AAC83555.1| 3926|Homo sapiens neuronal double zinc finger protein protein. Length = 3926 Score = 31.1 bits (67), Expect = 4.9 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -1 Query: 306 DGDSTSRTHNSQFNHPYGYQPPVQTADDIAAQPPPRSQADIDYELKVRKFLEMTKEDSDY 127 D +S SQ H Y + QPP R+ D + R+ LEM+ E+ + Sbjct: 798 DTAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARAAELTDEDFMRRQILEMSAEEDNL 857 Query: 126 EE 121 EE Sbjct: 858 EE 859 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,551,635 Number of Sequences: 237096 Number of extensions: 1454264 Number of successful extensions: 4438 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4434 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9924838204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -