BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L19 (786 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.4 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 5.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.8 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 24.2 bits (50), Expect = 1.4 Identities = 21/84 (25%), Positives = 35/84 (41%), Gaps = 4/84 (4%) Frame = -2 Query: 671 KTTEPFKRMTYIEAIEYLRANNITKED--GSFYEFGEDIPEMPERKMTDAIGVPILLCKF 498 +T PF + I+Y NNI + D E ++ ++ K+TD++ F Sbjct: 243 RTFAPFFTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLENIKLTDSLIAAQAFVFF 302 Query: 497 PA--EIKSFYMSRCVDDRRLTESV 432 A E S MS + + L + V Sbjct: 303 LAGFETSSTTMSNALYELALNQDV 326 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 315 PVVRARVDAFVLVTFHQLLVVPYPHGAA 398 P+ ++ F L T HQL V PH A Sbjct: 152 PMCSPKLHVFDLNTSHQLKQVVMPHDIA 179 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 380 WDHEELMEGYKHEGIDPSPYYWYT 309 WD ++EG + + D YW T Sbjct: 262 WDGSNMVEGNESDHNDGRLRYWRT 285 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 490 SAGNLHSSIGTPMASVIFRSGISGM 564 + G L S G PM + S +SGM Sbjct: 405 AGGQLPPSAGAPMPPIPNMSNMSGM 429 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,402 Number of Sequences: 438 Number of extensions: 3919 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -