BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_L18 (848 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.07 |||nuclear cap-binding complex large subunit |Schizo... 28 1.5 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 27 4.4 >SPAC6G10.07 |||nuclear cap-binding complex large subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 28.3 bits (60), Expect = 1.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +3 Query: 486 LNDFV-WLGH--LNFVFHWNWDLFLDSVGLGNGH 578 L+ F+ W H NF FHW W+ ++ V L + H Sbjct: 438 LDRFIDWFSHHLSNFNFHWKWNEWIPDVELDDLH 471 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 26.6 bits (56), Expect = 4.4 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 367 TKLRSPLTSPTRSK*RSP-IRSPLKCQYQNLTK 272 T L SPL SPT S R P +RS Q L+K Sbjct: 474 TDLLSPLPSPTSSNSRLPRVRSACTLNVQELSK 506 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,534,314 Number of Sequences: 5004 Number of extensions: 47896 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -